Filter: AllWBIHC

WB analysis using 28763-1-AP (same clone as 28763-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 28763-1-AP (HRH1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28763-1-PBS in a different storage buffer formulation.
IHC staining of mouse liver using 28763-1-AP (same clone as 28763-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 28763-1-AP (HRH1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28763-1-PBS in a different storage buffer formulation.

HRH1 Polyclonal antibody, PBS Only

Name: HRH1 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 28763-1-PBS

HRH1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 28763-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

H1 R, H1R, HH1R, hisH1, Histamine H1 receptor

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

28763-1-PBS targets HRH1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag30464 Product name: Recombinant human HRH1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 305-416 aa of BC060802 Sequence: LDIEHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQ Predict reactive species
Full Name	histamine receptor H1
Calculated Molecular Weight	487 aa, 56 kDa
Observed Molecular Weight	56 kDa
GenBank Accession Number	BC060802
Gene Symbol	HRH1
Gene ID (NCBI)	3269
RRID	AB_3086085
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P35367
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Able™