HS2ST1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• HS2ST1 Polyclonal antibody (12453-1-AP)

HS2ST1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 12453-1-AP Copied!

Publications (1)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

2 O sulfotransferase, 2OST, HS2ST, HS2ST1, KIAA0448

• 

  WB analysis of human liver using 12453-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 12453-1-AP (HS2ST1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human heart using 12453-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 12453-1-AP (HS2ST1 antibody) at dilution of 1:1200 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 12453-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 12453-1-AP (HS2ST1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of PC-3 using 12453-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 12453-1-AP (HS2ST1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lymphoma using 12453-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma using 12453-1-AP (HS2ST1 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for HS2ST1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human liver tissue, human brain tissue, human heart tissue, PC-3 cells
• Positive IHC detected in: human lymphoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2400
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12453-1-AP targets HS2ST1 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3111

  Product name: Recombinant human HS2ST1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 30-229 aa of BC025990

  Sequence: QIQKLEESRSKLERAIARHEVREIEQRHTMDGPRQDATLDEEEDMVIIYNRVPKTASTSFTNIAYDLCAKNKYHVLHINTTKNNPVMSLQDQVRFVKNITSWKEMKPGFYHGHVSYLDFAKFGVKKKPIYINVIRDPIERLVSYYYFLRFGDDYRPGLRRRKQGDKKTFDECVAEGGSDCAPEKLWLQIPFFCGHSSECW

• Full Name: heparan sulfate 2-O-sulfotransferase 1
• Calculated Molecular Weight: 229 aa, 27 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC025990
• Gene Symbol: HS2ST1
• Gene ID (NCBI): 9653
• RRID: AB_2119312
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7LGA3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The HS2ST1 Polyclonal antibody (Cat# 12453-1-AP) has 1 citation, published in Medicine (Baltimore) (2022). The study profiled HS2ST1 and SDC3 as predictive biomarkers for osteosarcoma, focusing on glycolysis pathways. The citation is associated with the research fields of oncology (osteosarcoma) and metabolic/glycolysis pathway analysis, with the antibody applied in IHC on human samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Medicine (Baltimore); Two novel predictive biomarkers for osteosarcoma and glycolysis pathways: A profiling study on HS2ST1 and SDC3; Authors - Guozhi Yang

Reviews

3.0 out of 5

1 verified customer reviews

What customers say

The single review for this product reports a 3-star rating from a Western Blot application at a 1:1000 dilution using a human pancreatic cancer cell line. The reviewer noted weak detection, suggesting the antibody's signal intensity may be suboptimal under these conditions. Overall, feedback is limited, with the only comment highlighting a concern about detection strength rather than specificity or background.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Bettina (Verified Customer) (08-05-2022)

Weak detection

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Human pancreatic cancer cell line

HS2ST1 Antibody Western Blot validation (1:1000 dilution) in Human pancreatic cancer cell line (Cat no:12453-1-AP)