HS2ST1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• HS2ST1 Polyclonal antibody, PBS Only (12453-1-PBS)

• 

  WB analysis of human liver using 12453-1-AP (same clone as 12453-1-PBS)

  human liver tissue were subjected to SDS PAGE followed by western blot with 12453-1-AP (HS2ST1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12453-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human heart using 12453-1-AP (same clone as 12453-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 12453-1-AP (HS2ST1 antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12453-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 12453-1-AP (same clone as 12453-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 12453-1-AP (HS2ST1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12453-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 12453-1-AP (same clone as 12453-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 12453-1-AP (HS2ST1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12453-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lymphoma using 12453-1-AP (same clone as 12453-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lymphoma using 12453-1-AP (HS2ST1 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 12453-1-PBS in a different storage buffer formulation.

HS2ST1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 12453-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

12453-1-PBS targets HS2ST1 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3111

  Product name: Recombinant human HS2ST1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 30-229 aa of BC025990

  Sequence: QIQKLEESRSKLERAIARHEVREIEQRHTMDGPRQDATLDEEEDMVIIYNRVPKTASTSFTNIAYDLCAKNKYHVLHINTTKNNPVMSLQDQVRFVKNITSWKEMKPGFYHGHVSYLDFAKFGVKKKPIYINVIRDPIERLVSYYYFLRFGDDYRPGLRRRKQGDKKTFDECVAEGGSDCAPEKLWLQIPFFCGHSSECW

• Full Name: heparan sulfate 2-O-sulfotransferase 1
• Calculated Molecular Weight: 229 aa, 27 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC025990
• Gene Symbol: HS2ST1
• Gene ID (NCBI): 9653
• RRID: AB_2119312
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7LGA3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.