Use Able AI chat for product recommendations
  • KD/KO Validated

HSCB Polyclonal antibody

HSCB Polyclonal Antibody for WB, IHC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IHC, ELISA

DNAJC20, HSC20, Iron-sulfur cluster co-chaperone protein HscB, Iron-sulfur cluster co-chaperone protein HscB, cytoplasmic, Iron-sulfur cluster co-chaperone protein HscB, mitochondrial

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for HSCB in ?

Tested Applications

Positive WB detected inrat liver tissue, HEK-293 cells
Positive IHC detected inhuman colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:200-1:1000
Immunohistochemistry (IHC)IHC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15132-1-AP targets HSCB in WB, IHC, ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag7268

Product name: Recombinant human HSCB protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-235 aa of BC065569

Sequence: MWRGRAGALLRVWGFWPTGVPRRRPLSCDAASQAGSNYPRCWNCGGPWGPGREDRFFCPQCRALQAPDPTRDYFSLMDCNRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVNDAYKTLLAPLSRGLYLLKLHGIEIPERTDYEMDRQFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKEFTDNVSSAFEQDDFEEAKEILTKMRYFSNIEEKIKLKKIPL

Predict reactive species
Full Name HscB iron-sulfur cluster co-chaperone homolog (E. coli)
Calculated Molecular Weight 27 kDa
Observed Molecular Weight 27-30 kDa
GenBank Accession NumberBC065569
Gene Symbol HSCB
Gene ID (NCBI) 150274
RRIDAB_2878110
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8IWL3
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HSCB, also named as HSC20 and DNAJC20, acts as a co-chaperone in iron-sulfur cluster assembly in mitochondria.

Protocols

Product Specific Protocols
IHC protocol for HSCB antibody 15132-1-APDownload protocol
WB protocol for HSCB antibody 15132-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The HSCB polyclonal antibody (Cat# 15132-1-AP) has 3 total citations. These appear in Science, Molecular Cell, and Cancers (Basel). The research fields span mitochondrial glutathione homeostasis and autoregulatory control, dual regulation of SLC25A39 by AFG3L2 and iron, and mutant p53 depletion via HSP40/J-domain protein inhibitors. All three studies used the antibody for Western blot in human samples.

SpeciesApplicationTitle
humanWB

Science

Autoregulatory control of mitochondrial glutathione homeostasis

Authors - Yuyang Liu
humanWB

Mol Cell

Dual regulation of SLC25A39 by AFG3L2 and iron controls mitochondrial glutathione homeostasis

Authors - Xiaojian Shi
humanWB

Cancers (Basel)

Mutant p53 Depletion by Novel Inhibitors for HSP40/J-Domain Proteins Derived from the Natural Compound Plumbagin

Authors - Mohamed Alalem

Reviews

    4.0 out of 5
Add a review

1 verified customer reviews

What customers say

One reviewer (4/5 stars) used this antibody for Western Blot on mouse embryonic stem cells at a 1:1000 dilution. The protocol involved a 4–12% Bis-Tris gradient gel with overnight transfer at 30V/4°C, SEA Block blocking buffer, and IRDye 800CW secondary antibody at 1:15000. The antibody detected the target in both whole cell lysate and mitochondrial fraction lysate. The reviewer noted the presence of one unspecific 15-kDa band. Overall, the antibody performed well for its intended application.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Lana (Verified Customer) (08-07-2020)

SDS-PAGE: 20 ug/ul RIPA protein lysate, 4-12% Bis-Tris gradient gel.Transfer: Immobilon-FL transfer membranes (Millipore) O/N at 30V, 4C.Blocking: SEA Block Blocking Buffer 1h, room T.Primary Ab: O/N incubation at 4C, 1:1000.Secondary Ab: IRDye 800CW Goat anti-Rabbit, 1:15000.Lines of WB image: 1 – protein ladder, 2 - whole cell lysate, 3 – mitochondrial fraction lysate, 4 – protein ladder.***One unspecific 15-kDa band is present.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Mouse embryonic stem cells
HSCB Antibody Western Blot validation (1:1000 dilution) in Mouse embryonic stem cells (Cat no:15132-1-AP)
Loading...
||
New chat

Able™

正在加载,请稍候...