HSCB Polyclonal antibody

• Home
• Products
• Primary Antibodies
• HSCB Polyclonal antibody (15132-1-AP)

• KD/KO Validated

HSCB Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15132-1-AP

Publications(3)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IHC, ELISA

Synonyms

DNAJC20, HSC20, Iron-sulfur cluster co-chaperone protein HscB, Iron-sulfur cluster co-chaperone protein HscB, cytoplasmic, Iron-sulfur cluster co-chaperone protein HscB, mitochondrial

• 

  WB analysis of rat liver using 15132-1-AP

  rat liver tissue were subjected to SDS PAGE followed by western blot with 15132-1-AP (HSCB antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 15132-1-AP

  WB result of HSCB antibody (15132-1-AP; 1:400; incubated at room temperature for 1.5 hours) with sh-Control and sh-HSCB transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 15132-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 15132-1-AP (HSCB antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: rat liver tissue, HEK-293 cells
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15132-1-AP targets HSCB in WB, IHC, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7268

  Product name: Recombinant human HSCB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-235 aa of BC065569

  Sequence: MWRGRAGALLRVWGFWPTGVPRRRPLSCDAASQAGSNYPRCWNCGGPWGPGREDRFFCPQCRALQAPDPTRDYFSLMDCNRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVNDAYKTLLAPLSRGLYLLKLHGIEIPERTDYEMDRQFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKEFTDNVSSAFEQDDFEEAKEILTKMRYFSNIEEKIKLKKIPL

• Full Name: HscB iron-sulfur cluster co-chaperone homolog (E. coli)
• Calculated Molecular Weight: 27 kDa
• Observed Molecular Weight: 27-30 kDa
• GenBank Accession Number: BC065569
• Gene Symbol: HSCB
• Gene ID (NCBI): 150274
• RRID: AB_2878110
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IWL3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HSCB, also named as HSC20 and DNAJC20, acts as a co-chaperone in iron-sulfur cluster assembly in mitochondria.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell; Dual regulation of SLC25A39 by AFG3L2 and iron controls mitochondrial glutathione homeostasis; Authors - Xiaojian Shi
human	WB	Science; Autoregulatory control of mitochondrial glutathione homeostasis; Authors - Yuyang Liu
human	WB	Cancers (Basel); Mutant p53 Depletion by Novel Inhibitors for HSP40/J-Domain Proteins Derived from the Natural Compound Plumbagin; Authors - Mohamed Alalem

Reviews

4.0 out of 5

1 verified customer reviews

What customers say

Automatically generated from the verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Lana (Verified Customer) (08-07-2020)

SDS-PAGE: 20 ug/ul RIPA protein lysate, 4-12% Bis-Tris gradient gel.Transfer: Immobilon-FL transfer membranes (Millipore) O/N at 30V, 4C.Blocking: SEA Block Blocking Buffer 1h, room T.Primary Ab: O/N incubation at 4C, 1:1000.Secondary Ab: IRDye 800CW Goat anti-Rabbit, 1:15000.Lines of WB image: 1 – protein ladder, 2 - whole cell lysate, 3 – mitochondrial fraction lysate, 4 – protein ladder.***One unspecific 15-kDa band is present.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Mouse embryonic stem cells

HSCB Antibody Western Blot validation (1:1000 dilution) in Mouse embryonic stem cells (Cat no:15132-1-AP)