HSCB Recombinant monoclonal antibody, PBS Only (Capture)

HSCB Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 85185-4-PBS
Clone No.242836H3

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, Cytometric bead array, Indirect ELISA

242836H3, DNAJC20, HSC20, Iron-sulfur cluster co-chaperone protein HscB, Iron-sulfur cluster co-chaperone protein HscB, cytoplasmic

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85185-4-PBS targets HSCB as part of a matched antibody pair:

MP01886-1: 85185-4-PBS capture and 85185-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag7268

Product name: Recombinant human HSCB protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-235 aa of BC065569

Sequence: MWRGRAGALLRVWGFWPTGVPRRRPLSCDAASQAGSNYPRCWNCGGPWGPGREDRFFCPQCRALQAPDPTRDYFSLMDCNRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVNDAYKTLLAPLSRGLYLLKLHGIEIPERTDYEMDRQFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKEFTDNVSSAFEQDDFEEAKEILTKMRYFSNIEEKIKLKKIPL

Predict reactive species
Full Name HscB iron-sulfur cluster co-chaperone homolog (E. coli)
Calculated Molecular Weight 27 kDa
Observed Molecular Weight 27 kDa
GenBank Accession NumberBC065569
Gene Symbol HSCB
Gene ID (NCBI) 150274
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8IWL3
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

HSCB, also named as HSC20 and DNAJC20, acts as a co-chaperone in iron-sulfur cluster assembly in mitochondria.

Loading...
||
New chat Able
正在加载,请稍候...