HSCB Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis of rat liver using 85185-4-RR (same clone as 85185-4-PBS)

  rat liver tissue were subjected to SDS PAGE followed by western blot with 85185-4-RR (HSCB antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85185-4-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP01886-1

  Cytometric bead array standard curve of MP01886-1, HSCB Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 85185-4-PBS. Detection antibody: 85185-3-PBS. Standard: Ag7268. Range: 0.313-40 ng/mL.

• 

  Affinity and Kinetic Characterization of 85185-4-RR

  Biolayer interferometry (BLl) kinetic assays of 85185-4-RR against Human HSCB were performed. The affinity constant is below 1 pM.

HSCB Uni-rAb^® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 85185-4-PBS

Clone No.242836H3

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, Cytometric bead array, Indirect ELISA

Synonyms

242836H3, DNAJC20, HSC20, Iron-sulfur cluster co-chaperone protein HscB, Iron-sulfur cluster co-chaperone protein HscB, cytoplasmic

---

Product Information

85185-4-PBS targets HSCB as part of a matched antibody pair:

MP01886-1: 85185-4-PBS capture and 85185-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7268

  Product name: Recombinant human HSCB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-235 aa of BC065569

  Sequence: MWRGRAGALLRVWGFWPTGVPRRRPLSCDAASQAGSNYPRCWNCGGPWGPGREDRFFCPQCRALQAPDPTRDYFSLMDCNRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVNDAYKTLLAPLSRGLYLLKLHGIEIPERTDYEMDRQFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKEFTDNVSSAFEQDDFEEAKEILTKMRYFSNIEEKIKLKKIPL

• Full Name: HscB iron-sulfur cluster co-chaperone homolog (E. coli)
• Calculated Molecular Weight: 27 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC065569
• Gene Symbol: HSCB
• Gene ID (NCBI): 150274
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8IWL3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HSCB, also named as HSC20 and DNAJC20, acts as a co-chaperone in iron-sulfur cluster assembly in mitochondria.