HSCB Recombinant monoclonal antibody

• 

  WB analysis of rat liver using 85185-4-RR

  rat liver tissue were subjected to SDS PAGE followed by western blot with 85185-4-RR (HSCB antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 85185-4-RR

  Biolayer interferometry (BLl) kinetic assays of 85185-4-RR against Human HSCB were performed. The affinity constant is below 1 pM.

HSCB Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 85185-4-RR

Clone No.242836H3

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, ELISA

Synonyms

242836H3, DNAJC20, HSC20, Iron-sulfur cluster co-chaperone protein HscB, Iron-sulfur cluster co-chaperone protein HscB, cytoplasmic

---

Tested Applications

• Positive WB detected in: rat liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

85185-4-RR targets HSCB in WB, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7268

  Product name: Recombinant human HSCB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-235 aa of BC065569

  Sequence: MWRGRAGALLRVWGFWPTGVPRRRPLSCDAASQAGSNYPRCWNCGGPWGPGREDRFFCPQCRALQAPDPTRDYFSLMDCNRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVNDAYKTLLAPLSRGLYLLKLHGIEIPERTDYEMDRQFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKEFTDNVSSAFEQDDFEEAKEILTKMRYFSNIEEKIKLKKIPL

• Full Name: HscB iron-sulfur cluster co-chaperone homolog (E. coli)
• Calculated Molecular Weight: 27 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC065569
• Gene Symbol: HSCB
• Gene ID (NCBI): 150274
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8IWL3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HSCB, also named as HSC20 and DNAJC20, acts as a co-chaperone in iron-sulfur cluster assembly in mitochondria.