HSD11B2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• HSD11B2 Polyclonal antibody (14192-1-AP)

HSD11B2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 14192-1-AP Copied!

Publications (30)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

11-beta-hydroxysteroid dehydrogenase type II, 11-beta-hydroxysteroid dehydrogenase type 2, 11-beta-HSD2, 11-beta-HSD type II, 11 DH2

• 

  WB analysis using 14192-1-AP

  Human placenta tissue lysates were subjected to SDS PAGE followed by western blot with 14192-1-AP (HSD11B2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human kidney using 14192-1-AP

  human kidney tissue were subjected to SDS PAGE followed by western blot with 14192-1-AP (HSD11B2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse kidney using 14192-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 14192-1-AP (HSD11B2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Transfected HEK-293 using 14192-1-AP

  Transfected HEK-293 cells were subjected to SDS PAGE followed by western blot with 14192-1-AP (HSD11B2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 14192-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 14192-1-AP (HSD11B2 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 14192-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 14192-1-AP (HSD11B2 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for HSD11B2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human placenta tissue, mouse kidney tissue, human kidney tissue, Transfected HEK-293 cells
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14192-1-AP targets HSD11B2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5146

  Product name: Recombinant human HSD11B2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-405 aa of BC036780

  Sequence: MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALAVLAAAGWIALSRLARPQRLPVATRAVLITGCDSGFGKETAKKLDSMGFTVLATVLELNSPGAIELRTCCSPRLRLLQMDLTKPGDISRVLEFTKAHTTSTGLWGLVNNAGHNEVVADAELSPVATFRSCMEVNFFGALELTKGLLPLLRSSRGRIVTVGSPAGDMPYPCLGAYGTSKAAVALLMDTFSCELLPWGVKVSIIQPGCFKTESVRNVGQWEKRKQLLLANLPQELLQAYGKDYIEHLHGQFLHSLRLAMSDLTPVVDAITDALLAARPRRRYYPGQGLGLMYFIHYYLPEGLRRRFLQAFFISHCLPRALQPGQPGTTPPQDAAQGPNLSPGPSPAVAR

• Full Name: hydroxysteroid (11-beta) dehydrogenase 2
• Calculated Molecular Weight: 405 aa, 44 kDa
• Observed Molecular Weight: 40-43 kDa
• GenBank Accession Number: BC036780
• Gene Symbol: HSD11B2
• Gene ID (NCBI): 3291
• RRID: AB_2119643
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P80365
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The HSD11B2 gene encodes the type II isoform of 11-beta-hydroxysteroid dehydrogenase, a microsomal enzyme complex responsible for the interconversion of biologically active cortisol and inactive cortisone. This protein catalyzes the cortisol-to-cortisone reaction. This protein expresses approximately 44 kDa in placenta, trophoblast, and distal colon, but in kidney tissue, there are two bands of approximately 44 and 48 kDa can be consistently observed and no signal is seen in decidua, adrenal, or liver(PMID:9048640). HSD11B2 protein was detected in CEM-C7 cells via immunoblot analysis as a dimer and trimer of approximately 80 and 120 kDa (PMID:23762608).

Publications

What published studies show

The HSD11B2 Polyclonal antibody (Cat# 14192-1-AP) has accumulated 30 citations published in journals including Nature, Science Advances, Hypertension, FASEB Journal, BMC Cancer, Carcinogenesis, Placenta, and Brain Research. Associated research fields encompass neuroscience (sodium appetite and neural circuits), endocrinology (glucocorticoid and mineralocorticoid signaling), placental and reproductive biology, oncology (colorectal, oral, and head/neck cancers), pharmacology, immunology, and metabolic diseases such as diabetic kidney disease.

Automatically generated from the 30 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	Nature; Chemosensory modulation of neural circuits for sodium appetite.; Authors - Sangjun Lee
mouse	IF	Sci Adv; A gut-brain axis mediates sodium appetite via gastrointestinal peptide regulation on a medulla-hypothalamic circuit; Authors - Yuchu Liu
human,rat	WB	Phytomedicine; Erchen Decoction ameliorates the rat model of polycystic ovary syndrome by regulating the steroid biosynthesis pathway; Authors - Jinrong Zhang
mouse	IF	Hypertension; Mineralocorticoid Receptor Antagonists Cause Natriuresis in the Absence of Aldosterone; Authors - Yujiro Maeoka
mouse	WB	J Ethnopharmacol; Huangkui capsule, an extract from Abelmoschus manihot (L.) medic, inhibits adrenal aldosterone synthesis and renal ERK/EGR1 pathway in the treatment of diabetic kidney disease; Authors - Rengui Saxu
mouse, human	WB,IHC	J Agric Food Chem; Zearalenone Disrupts the Placental Barrier via Integrated Stress Response Activation in Mice and Human Trophoblast Cells.; Authors - Fang-Nan Wu