Product Information
27461-1-PBS targets HSD17B12 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26540 Product name: Recombinant human HSD17B12 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 203-271 aa of BC012043 Sequence: SATKTFVDFFSQCLHEEYRSKGVFVQSVLPYFVATKLAKIRKPTLDKPSPETFVKSAIKTVGLQSRTNG Predict reactive species |
| Full Name | hydroxysteroid (17-beta) dehydrogenase 12 |
| Calculated Molecular Weight | 312 aa, 34 kDa |
| Observed Molecular Weight | 30 kDa |
| GenBank Accession Number | BC012043 |
| Gene Symbol | HSD17B12 |
| Gene ID (NCBI) | 51144 |
| RRID | AB_3669604 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q53GQ0 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Hydroxysteroid 17-beta dehydrogenase 12 (HSD17B12, also known as KAR and SDR12C1) is a key enzyme of steroid metabolism pathway19 and is the human homolog of the yeast 3-ketoacyl-CoA reductase that catalyzes the second reaction in each VLCFA elongation cycle (PMID: 16166196; 12482854). It also acts as a drug-metabolizing enzyme (PMID: 36724833). HSD17B12 deficiency in embryonic stem cells reduced the production of arachidonic acid, a precursor of prostaglandins (PMID: 20130115).







