HSD17B4 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 86334-2-RR (same clone as 86334-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86334-2-RR (HSD17B4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86334-2-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 86334-2-RR (same clone as 86334-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using HSD17B4 antibody (86334-2-RR, Clone: 251058E1 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 86334-2-PBS in a different storage buffer formulation.

• 

  Cytometric bead array sample test of MP02361-1

  The mean HSD17B4 concentration was determined to be 3562.2 ng/mL in Hela cell extract based on a 1.5 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP02361-1

  Cytometric bead array standard curve of MP02361-1, HSD17B4 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 86334-2-PBS. Detection antibody: 86334-1-PBS. Standard: Ag7165. Range: 1.562-200 ng/mL.

• 

  Affinity and Kinetic Characterization of 86334-2-RR

  Biolayer interferometry (BLl) kinetic assays of 86334-2-RR against Human HSD17B4 were performed. The affinity constant is below 1 pM.

HSD17B4 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA

Cat No. 86334-2-PBS

Clone No.251058E1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

Synonyms

(3R)-hydroxyacyl-CoA dehydrogenase, 17 beta HSD 4, 17-beta-HSD 4, 17-beta-hydroxysteroid dehydrogenase 4, D bifunctional protein

---

Product Information

86334-2-PBS targets HSD17B4 as part of a matched antibody pair:

MP02361-1: 86334-2-PBS capture and 86334-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7165

  Product name: Recombinant human HSD17B4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 436-736 aa of BC003098

  Sequence: GSGVVIIMDVYSYSEKELICHNQFSLFLVGSGGFGGKRTSDKVKVAVAIPNRPPDAVLTDTTSLNQAALYRLSGDWNPLHIDPNFASLAGFDKPILHGLCTFGFSARRVLQQFADNDVSRFKAIKARFAKPVYPGQTLQTEMWKEGNRIHFQTKVQETGDIVISNAYVDLAPTSGTSAKTPSEGGKLQSTFVFEEIGRRLKDIGPEVVKKVNAVFEWHITKGGNIGAKWTIDLKSGSGKVYQGPAKGAADTTIILSDEDFMEVVLGKLDPQKAFFSGRLKARGNIMLSQKLQMILKDYAKL

• Full Name: hydroxysteroid (17-beta) dehydrogenase 4
• Calculated Molecular Weight: 80 kDa
• Observed Molecular Weight: 75 kDa, 45 kDa
• GenBank Accession Number: BC003098
• Gene Symbol: HSD17B4
• Gene ID (NCBI): 3295
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P51659
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HSD17B4 (17-beta-hydroxysteroid dehydrogenase 4) is also named as Peroxisomal multifunctional enzyme type 2, D-bifuntional protein or multifunctional protein 2. It codes for a 80 kDa enzyme containing three distinct functional domains and is localized in peroxisomes. It is a bifunctional enzyme acting on the peroxisomal beta-oxidation pathway for fatty acids and catalyzing the formation of 3-ketoacyl-CoA intermediates from both straight-chain and 2-methyl-brancked-chian fatty acids. After peroxisomal import, the full-length protein is proteolytically cleaved to yield a 35-kDa dehydrogenase subunit and a 45-kDa hydratase subunit containing the hydratase and SCP domains (PMID: 28868548, 24602372).