HSD17B4 Recombinant monoclonal antibody

• 

  WB analysis using 86334-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86334-2-RR (HSD17B4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 86334-2-RR

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using HSD17B4 antibody (86334-2-RR, Clone: 251058E1 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  Affinity and Kinetic Characterization of 86334-2-RR

  Biolayer interferometry (BLl) kinetic assays of 86334-2-RR against Human HSD17B4 were performed. The affinity constant is below 1 pM.

HSD17B4 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 86334-2-RR

Clone No.251058E1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, ELISA

Synonyms

(3R)-hydroxyacyl-CoA dehydrogenase, 17 beta HSD 4, 17-beta-HSD 4, 17-beta-hydroxysteroid dehydrogenase 4, D bifunctional protein

---

Tested Applications

• Positive WB detected in: K-562 cells, HeLa cells, HepG2 cells, mouse liver tissue
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86334-2-RR targets HSD17B4 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7165

  Product name: Recombinant human HSD17B4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 436-736 aa of BC003098

  Sequence: GSGVVIIMDVYSYSEKELICHNQFSLFLVGSGGFGGKRTSDKVKVAVAIPNRPPDAVLTDTTSLNQAALYRLSGDWNPLHIDPNFASLAGFDKPILHGLCTFGFSARRVLQQFADNDVSRFKAIKARFAKPVYPGQTLQTEMWKEGNRIHFQTKVQETGDIVISNAYVDLAPTSGTSAKTPSEGGKLQSTFVFEEIGRRLKDIGPEVVKKVNAVFEWHITKGGNIGAKWTIDLKSGSGKVYQGPAKGAADTTIILSDEDFMEVVLGKLDPQKAFFSGRLKARGNIMLSQKLQMILKDYAKL

• Full Name: hydroxysteroid (17-beta) dehydrogenase 4
• Calculated Molecular Weight: 80 kDa
• Observed Molecular Weight: 75 kDa, 45 kDa
• GenBank Accession Number: BC003098
• Gene Symbol: HSD17B4
• Gene ID (NCBI): 3295
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P51659
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HSD17B4 (17-beta-hydroxysteroid dehydrogenase 4) is also named as Peroxisomal multifunctional enzyme type 2, D-bifuntional protein or multifunctional protein 2. It codes for a 80 kDa enzyme containing three distinct functional domains and is localized in peroxisomes. It is a bifunctional enzyme acting on the peroxisomal beta-oxidation pathway for fatty acids and catalyzing the formation of 3-ketoacyl-CoA intermediates from both straight-chain and 2-methyl-brancked-chian fatty acids. After peroxisomal import, the full-length protein is proteolytically cleaved to yield a 35-kDa dehydrogenase subunit and a 45-kDa hydratase subunit containing the hydratase and SCP domains (PMID: 28868548, 24602372).