HSD17B6 Monoclonal antibody, PBS Only

• 

  WB analysis using 67496-1-Ig (same clone as 67496-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67496-1-Ig (HSD17B6 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67496-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Daudi using 67496-1-Ig (same clone as 67496-1-PBS)

  Daudi cells were subjected to SDS PAGE followed by western blot with 67496-1-Ig (HSD17B6 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67496-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67496-1-Ig (same clone as 67496-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67496-1-Ig (HSD17B6 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67496-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67496-1-Ig (same clone as 67496-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67496-1-Ig (HSD17B6 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67496-1-PBS in a different storage buffer formulation.

HSD17B6 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67496-1-PBS

Clone No.2D4G6

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, IHC, Indirect ELISA

Synonyms

17 beta HSD 6, 17 beta HSD6, 3 alpha >beta HSE, HSD17B6, HSE, RODH, SDR9C6

---

Product Information

67496-1-PBS targets HSD17B6 in WB, IHC, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17330

  Product name: Recombinant human HSD17B6 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-317 aa of BC020710

  Sequence: MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLDARGLRVLAACLTEKGAEQLRGQTSDRLETVTLDVTKMESIAAATQWVKEHVGDRGLWGLVNNAGILTPITLCEWLNTEDSMNMLKVNLIGVIQVTLSMLPLVRRARGRIVNVSSILGRVAFFVGGYCVSKYGVEAFSDILRREIQHFGVKISIVEPGYFRTGMTNMTQSLERMKQSWKEAPKHIKETYGQQYFDALYNIMKEGLLNCSTNLNLVTDCMEHALTSVHPRTRYSAGWDAKFFFIPLSYLPTSLADYILTRSWPKPAQAV

• Full Name: hydroxysteroid (17-beta) dehydrogenase 6 homolog (mouse)
• Calculated Molecular Weight: 317 aa, 36 kDa
• Observed Molecular Weight: 33-35 kDa
• GenBank Accession Number: BC020710
• Gene Symbol: HSD17B6
• Gene ID (NCBI): 8630
• RRID: AB_2882720
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O14756
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.