HSD3B2 Polyclonal antibody

HSD3B2 Polyclonal Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 15516-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, FC (Intra), ELISA

3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2, 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type II, 3b HSD, 3-beta-HSD adrenal and gonadal type, 3-beta-HSD II

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse testis tissue
Positive IHC detected inrat testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:5000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15516-1-AP targets HSD3B2 in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, canine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag7782

Product name: Recombinant human HSD3B2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-286 aa of BC038419

Sequence: MGWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQNRTKLTVLEGDILDEPFLKRACQDVSVVIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLENTWPTPYPYSKKLAEKAVLAANGWNLKNGDTLYTCALRPTYIYGEGGPFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRALRDPKKAPSVRGQFYYISDDTPHQSYDNLNYILSKEFGLRLDSRWSLP

Predict reactive species
Full Name hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2
Calculated Molecular Weight 42 kDa
Observed Molecular Weight 42 kDa
GenBank Accession NumberBC038419
Gene Symbol HSD3B2
Gene ID (NCBI) 3284
RRIDAB_2120111
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP26439
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HSD3B2(3-beta-hydroxy-Delta(5)-steroid dehydrogenase) belongs to the 3-beta-HSD family and catalyzes the oxidation and isomerization of delta-5-3-beta-hydroxysteroid precursors into delta-4-ketosteroids, thus leading to the formation of all classes of steroid hormones.HSD3B2 is expressed almost exclusively in adrenals and gonads, whereas HSD3B1 is expressed predominantly in placenta and skin (PMID:1682237). HSD3B2 plays a crucial role in steroid hormone biosynthesis and is thus of particular interest in hormone dependent tumors such as prostate cancer. Compared with normal tissue cytoplasmic HSD3B2 staining was stronger in prostate cancers (PMID: 29803408). Defects in HSD3B2 are the cause of adrenal hyperplasia type 2 (AH2).

Protocols

Product Specific Protocols
WB protocol for HSD3B2 antibody 15516-1-APDownload protocol
IHC protocol for HSD3B2 antibody 15516-1-APDownload protocol
FC protocol for HSD3B2 antibody 15516-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

J Hazard Mater

Tributyltin chloride (TBTCL) induces cell injury via dysregulation of endoplasmic reticulum stress and autophagy in Leydig cells

Authors - Pengchen Chen
humanWB

Oncotarget

Generation and characteristics of human Sertoli cell line immortalized by overexpression of human telomerase.

Authors - Liping Wen
ratWB,IHC

Endocrinology

A dietary medium-chain fatty acid, decanoic acid, inhibits recruitment of Nur77 to the HSD3B2 promoter in vitro, and reverses endocrine and metabolic abnormalities in a rat model of polycystic ovary syndrome.

Authors - Bao Hui Lee
mouseIF

Front Physiol

Long-Term Maintenance and Meiotic Entry of Early Germ Cells in Murine Testicular Organoids Functionalized by 3D Printed Scaffolds and Air-Medium Interface Cultivation.

Authors - Guillaume Richer
mouseIHC

Reprod Biomed Online

Brain-derived neurotrophic factor expression in granulosa lutein cells.

Authors - Dominguez Miguel A MA
humanIHC

Int J Clin Exp Pathol

Ectopic cortisol-producing adrenocortical adenoma in the renal hilum: histopathological features and steroidogenic enzyme profile.

Authors - Anli Tong
Loading...
||
New chat Able
正在加载,请稍候...