HSD3B2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• HSD3B2 Polyclonal antibody (15516-1-AP)

HSD3B2 Polyclonal Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 15516-1-AP Copied!

Publications (23)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, FC (Intra), ELISA

Synonyms

3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2, 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type II, 3b HSD, 3-beta-HSD adrenal and gonadal type, 3-beta-HSD II

• 

  WB analysis of mouse testis using 15516-1-AP

  mouse testis tissue was subjected to SDS PAGE followed by western blot with 15516-1-AP (HSD3B2 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat testis using 15516-1-AP

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 15516-1-AP (HSD3B2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat testis using 15516-1-AP

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 15516-1-AP (HSD3B2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HeLa using 15516-1-AP

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug HSD3B2 Polyclonal antibody (15516-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for HSD3B2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse testis tissue
• Positive IHC detected in: rat testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15516-1-AP targets HSD3B2 in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, canine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7782

  Product name: Recombinant human HSD3B2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-286 aa of BC038419

  Sequence: MGWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQNRTKLTVLEGDILDEPFLKRACQDVSVVIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLENTWPTPYPYSKKLAEKAVLAANGWNLKNGDTLYTCALRPTYIYGEGGPFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRALRDPKKAPSVRGQFYYISDDTPHQSYDNLNYILSKEFGLRLDSRWSLP

• Full Name: hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2
• Calculated Molecular Weight: 42 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC038419
• Gene Symbol: HSD3B2
• Gene ID (NCBI): 3284
• RRID: AB_2120111
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P26439
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HSD3B2(3-beta-hydroxy-Delta(5)-steroid dehydrogenase) belongs to the 3-beta-HSD family and catalyzes the oxidation and isomerization of delta-5-3-beta-hydroxysteroid precursors into delta-4-ketosteroids, thus leading to the formation of all classes of steroid hormones.HSD3B2 is expressed almost exclusively in adrenals and gonads, whereas HSD3B1 is expressed predominantly in placenta and skin (PMID:1682237). HSD3B2 plays a crucial role in steroid hormone biosynthesis and is thus of particular interest in hormone dependent tumors such as prostate cancer. Compared with normal tissue cytoplasmic HSD3B2 staining was stronger in prostate cancers (PMID: 29803408). Defects in HSD3B2 are the cause of adrenal hyperplasia type 2 (AH2).

Publications

What published studies show

The anti-StAR antibody (Cat# 15516-1-AP) has 23 citations spanning journals including Adv Sci, J Hazard Mater, Mol Med, Environ Pollut, Int J Mol Sci, Endocrinology, Oncotarget, Sci Rep, and Reproduction. Research fields center on reproductive endocrinology, covering Leydig cell steroidogenesis, testicular lipid homeostasis, ovarian granulosa cell luteinization, spermatogenesis, PCOS models, oxidative stress, and ferroptosis in gonadal tissues.

Automatically generated from the 23 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	J Nanobiotechnology; Ti3C2 nanosheet-induced autophagy derails ovarian functions; Authors - Limei Yang
mouse	IHC	Adv Sci (Weinh); Ex Vivo Spatiotemporal Characterization of Spermatogenesis in Mouse Testicular Organoids.; Authors - Jiachen Sun
mouse	WB	J Hazard Mater; Tributyltin chloride (TBTCL) induces cell injury via dysregulation of endoplasmic reticulum stress and autophagy in Leydig cells; Authors - Pengchen Chen
mouse	WB	Mol Med; The downregulation of hormone-sensitive lipase and dysregulation of cholesterol receptors/transporter affect testicular lipid homeostasis and function in HFD-induced oligoasthenospermia mice; Authors - Min Pan
mouse	WB,IF	Antioxidants (Basel); Bioactive Peptide C248 of PRDX4 Ameliorates the Function of Testicular Leydig Cells via Mitochondrial Protection.; Authors - Nini Wei
mouse	WB,IHC	Environ Pollut; Arsenic exposure reduces testosterone synthesis partially by evoking Leydig cell ferroptosis in mouse testes.; Authors - Xiao-Yi Zhang