• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated HSF1 Monoclonal antibody

HSF1 Monoclonal Antibody for IF/ICC
Cat No. CL488-67189
Clone No.1F10A5

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

IF/ICC

Heat shock factor protein 1, HSF 1, HSF1, HSTF 1, HSTF1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67189 targets HSF1 in IF/ICC applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag29061

Product name: Recombinant human HSF1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 230-529 aa of BC014638

Sequence: SLEHVHGSGPYSAPSPAYSSSSLYAPDAVASSGPIISDITELAPASPMASPGGSIDERPLSSSPLVRVKEEPPSPPQSPRVEEASPGRPSSVDTLLSPTALIDSILRESEPAPASVTALTDARGHTDTEGRPPSPPPTSTPEKCLSVACLDKNELSDHLDAMDSNLDNLQTMLSSHGFSVDTSALLDLFSPSVTVPDMSLPDLDSSLASIQELLSPQEPPRPPEAENSSPDSGKQLVHYTAQPLFLLDPGSVDTGSNDLPVLFELGEGSYFSEGDGFAEDPTISLLTGSEPPKAKDPTVS

Predict reactive species
Full Name heat shock transcription factor 1
Calculated Molecular Weight 529 aa, 57 kDa
Observed Molecular Weight 68-80 kDa
GenBank Accession NumberBC014638
Gene Symbol HSF1
Gene ID (NCBI) 3297
RRIDAB_2919433
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ00613
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

HSF1 belongs to heat-shock transcription factors that activate heat-shock response genes under conditions of heat or other stresses. Also, HSF1 has been linked with oogenesis, spermatogenesis, and placental development. It can activate AKT and inactivate JNK and CASP3 to protect cardiomyocytes from death. And it has a role in the regulation of life span and establishes a role for SIRT1 in protein homeostasis and heat-shock response. The calculated molecular weight of HSF1 is 57 kDa, but HSF1 migrates at approximately 80 kDa which likely represents different phosphorylation states (PMID: 18434628).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 HSF1 antibody CL488-67189Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...