HSF2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• HSF2 Polyclonal antibody, PBS Only (10706-1-PBS)

• 

  WB analysis using 10706-1-AP (same clone as 10706-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10706-1-AP (HSF2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10706-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 10706-1-AP (same clone as 10706-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 10706-1-AP (HSF2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10706-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 10706-1-AP (same clone as 10706-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 10706-1-AP (HSF2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10706-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 10706-1-AP (same clone as 10706-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 10706-1-AP (HSF2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10706-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat testis using 10706-1-AP (same clone as 10706-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 10706-1-AP (HSF2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10706-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat testis using 10706-1-AP (same clone as 10706-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 10706-1-AP (HSF2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10706-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

HSF2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 10706-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

10706-1-PBS targets HSF2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1067

  Product name: Recombinant human HSF2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-230 aa of BC005329

  Sequence: MKQSSNVPAFLSKLWTLVEETHTNEFITWSQNGQSFLVLDEQRFAKEILPKYFKHNNMASFVRQLNMYGFRKVVHIDSGIVKQERDGPVEFQHPYFKQGQDDLLENIKRKVSSSKPEENKIRQEDLTKIISSAQKVQIKQETIESRLSELKSENESLWKEVSELRAKHAQQQQVIRKIVQFIVTLVQNNQLVSLKRKRPLLLNTNGAQKKNLFQHIVKEPTDNHHHKVIF

• Full Name: heat shock transcription factor 2
• Calculated Molecular Weight: 79 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC005329
• Gene Symbol: HSF2
• Gene ID (NCBI): 3298
• RRID: AB_2120443
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q03933
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.