HSF5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• HSF5 Polyclonal antibody, PBS Only (17765-1-PBS)

• 

  WB analysis of Jurkat using 17765-1-AP (same clone as 17765-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 17765-1-AP (HSF5 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17765-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 17765-1-AP (same clone as 17765-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 17765-1-AP (HSF5 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17765-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse testis using 17765-1-AP (same clone as 17765-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse testis tissue using HSF5 antibody (17765-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17765-1-PBS in a different storage buffer formulation.

HSF5 Polyclonal Antibody for WB, IF-P, Indirect ELISA

Cat No. 17765-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF-P, Indirect ELISA

Synonyms

HSTF5, HSTF 5, HSF 5

---

Product Information

17765-1-PBS targets HSF5 in WB, IF-P, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12168

  Product name: Recombinant human HSF5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC033017

  Sequence: MEALLSTPINPNNFPAKLWRLVNSPRYRSIRWDGRGEGLLIDQPLFEAELLSPPGPGGGGGTAGAGAEPELFKTTSFTSFIRQLNLYGFRKVVLGGPGGGKPAGNGPLHHFHNPHFRRDQPQLLVHLKRLTSANKAKLAAGLEVPCRPPNRFQRLLITSASAATAPLQHQQPPPPAGPRPEPHGPVAVGQFHRSFRRDSLSPYSCVSTPSHDHSTYPLKGLDRTPVPHRIWQNSLGMHPGQVETSPTFSDKGVPFPVLQRFPTEVTYTLQPSTTSVHVQQGPQTMVSSSQKYSNYTPSAQYSQAYYPTAVLQCCSPTHMDALSSCVTPTASSYAHCNYFQNPSMQSSYPV

• Full Name: heat shock transcription factor family member 5
• Calculated Molecular Weight: 596 aa, 65 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: BC033017
• Gene Symbol: HSF5
• Gene ID (NCBI): 124535
• RRID: AB_2233301
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q4G112
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Heat shock transcription factor 5 (HSF5) is a member of the HSF family, which are well-known transcriptional regulators of genes encoding heat shock proteins and other types of proteins and have functions in reproduction, the immune response, and the aging process. HSF5 is a non-canonical HSF that possesses a winged- helix-turn-helix (WHTH)-like DNA-binding domain and is specifically expressed in the testis (PMID: 38958533, PMID: 39162221).