HSP27 Monoclonal antibody, PBS Only

• 

  WB analysis using 66767-1-Ig (same clone as 66767-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66767-1-Ig (HSPB1 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66767-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66767-1-Ig (same clone as 66767-1-PBS)

  WB result of HSP27 antibody (66767-1-Ig; 1:60000; incubated at room temperature for 1.5 hours) with sh-Control and sh-HSP27 transfected HeLa cells. This data was developed using the same antibody clone with 66767-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HSC-T6 using 66767-1-Ig (same clone as 66767-1-PBS)

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 66767-1-Ig (HSPB1 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66767-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 66767-1-Ig (same clone as 66767-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 66767-1-Ig (HSPB1 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66767-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 66767-1-Ig (same clone as 66767-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 66767-1-Ig (HSPB1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66767-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 66767-1-Ig (same clone as 66767-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66767-1-Ig (HSP27 antibody) at dilution of 1:8000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66767-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 66767-1-Ig (same clone as 66767-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using HSP27 antibody (66767-1-Ig, Clone: 3E7A1 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66767-1-PBS in a different storage buffer formulation.

• 

  IF Staining of zebrafish retina using 66767-1-Ig (same clone as 66767-1-PBS)

  Antibody staining on tissue sections of the zebrafish retina at 5 days post fertilisation (dpf) for Heatshock protein 27 (Hsp27;magenta); (#66767-1-Ig) Dilution 1:200. Tissue fixed overnight in 4% PFA; DAPI, blue. Data generated by Natalia Jaroszynska in Professor Ryan MacDonald's lab, University College London, UK. This data was developed using the same antibody clone with 66767-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 66767-1-Ig (same clone as 66767-1-PBS)

  1X10^6 HepG2 cells were intracellularly stained with 0.5 ug Anti-Human HSP27 (66767-1-Ig, Clone:3E7A1) (red) labeled with FlexAble CoraLite® Plus 555 Antibody Labeling Kit for Mouse IgG1 (KFA022), or 0.5 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 66767-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

HSP27 Monoclonal Antibody for WB, IHC, IF, FC (Intra), Indirect ELISA

Cat No. 66767-1-PBS

Clone No.3E7A1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, zebrafish

Applications

WB, IHC, IF, FC (Intra), Indirect ELISA

Synonyms

HSPB1, 3E7A1, CMT2F, Estrogen-regulated 24 kDa protein, HMN2B

---

Product Information

66767-1-PBS targets HSP27 in WB, IHC, IF, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat, zebrafish samples.

• Tested Reactivity: human, mouse, rat, zebrafish
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27859

  Product name: Recombinant human HSPB1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-205 aa of BC012768

  Sequence: MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK

• Full Name: heat shock 27kDa protein 1
• Calculated Molecular Weight: 19-23 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC012768
• Gene Symbol: HSPB1
• Gene ID (NCBI): 3315
• RRID: AB_2882113
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P04792
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HSPB1, also known as heat shock protein 27 (Hsp27), belongs to the small heat shock protein family which is induced in response to environmental challenges or/and developmental transitions. It is also an anti-apoptotic protein that plays crucial roles in tumorigenesis and cell survival and is reported to be an independent prognosis marker for cancer. Recently HSPB1 has been found to be a valuable marker for melanoma. In addition to the predicted 27 kDa, an extra 50-55 kDa representing dimeric form of HSPB1 may also be observed (21353161).