Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

HSP27 Monoclonal antibody

HSP27 Monoclonal Antibody for WB, IHC, IF, FC (Intra), ELISA

Cat No. 66767-1-Ig
Clone No.3E7A1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, zebrafish

Applications

WB, IHC, IF, FC (Intra), ELISA

HSPB1, 3E7A1, CMT2F, Estrogen-regulated 24 kDa protein, HMN2B

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHCT 116 cells, HeLa cells, HSC-T6 cells, mouse liver tissue, U2OS cells, A549 cells, HepG2 cells, HuH-7 cells
Positive IHC detected inhuman gliomas tissue, human liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF detected inzebrafish retina, MCF-7 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:20000-1:100000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)IF : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66767-1-Ig targets HSP27 in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, zebrafish samples.

Tested Reactivity human, mouse, rat, zebrafish
Cited Reactivityhuman, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag27859

Product name: Recombinant human HSPB1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-205 aa of BC012768

Sequence: MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK

Predict reactive species
Full Name heat shock 27kDa protein 1
Calculated Molecular Weight 19-23 kDa
Observed Molecular Weight 27 kDa
GenBank Accession NumberBC012768
Gene Symbol HSPB1
Gene ID (NCBI) 3315
RRIDAB_2882113
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP04792
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HSPB1, also known as heat shock protein 27 (Hsp27), belongs to the small heat shock protein family which is induced in response to environmental challenges or/and developmental transitions. It is also an anti-apoptotic protein that plays crucial roles in tumorigenesis and cell survival and is reported to be an independent prognosis marker for cancer. Recently HSPB1 has been found to be a valuable marker for melanoma. In addition to the predicted 27 kDa, an extra 50-55 kDa representing dimeric form of HSPB1 may also be observed (21353161).

Protocols

Product Specific Protocols
FC protocol for HSP27 antibody 66767-1-IgDownload protocol
IF protocol for HSP27 antibody 66767-1-IgDownload protocol
IHC protocol for HSP27 antibody 66767-1-IgDownload protocol
WB protocol for HSP27 antibody 66767-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
ratWB

Nat Commun

Directed rescue strategy for enhanced implant osteointegration in aged rats.

Authors - Xuan Li

Hum Reprod

T-cadherin inhibits invasion and migration of endometrial stromal cells in endometriosis.

Authors - Qinsheng Lu
humanIF

Oncol Rep

SUMOylation of HSP27 regulates PKM2 to promote esophageal squamous cell carcinoma progression.

Authors - Xiao Zhang
mouseWB

PLoS One

Integrated RNA-seq and scRNA-seq to explore the biological mechanisms of mitophagy-related genes in ulcerative colitis.

Authors - Jianguo Ma
humanIF

Hum Mol Genet

C-terminal extension of HSPB6 in a family with myopathy and cataract.

Authors - Jaakko Sarparanta
humanWB,IHC,IF

Drug Resist Updat

Targeting the USP5-HSPB1 axis overcomes ferroptosis resistance in intrahepatic cholangiocarcinoma.

Authors - Chengbin He
Loading...
||
New chat

Able

正在加载,请稍候...