• Featured Product
  • KD/KO Validated

HSP27 Monoclonal antibody

HSP27 Monoclonal Antibody for WB, IHC, IF, FC (Intra), ELISA
Cat No. 66767-1-Ig
Clone No.3E7A1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, zebrafish

Applications

WB, IHC, IF, FC (Intra), ELISA

HSPB1, 3E7A1, CMT2F, Estrogen-regulated 24 kDa protein, HMN2B

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHCT 116 cells, HeLa cells, HSC-T6 cells, mouse liver tissue, U2OS cells, A549 cells, HepG2 cells, HuH-7 cells
Positive IHC detected inhuman gliomas tissue, human liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF detected inzebrafish retina, MCF-7 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:20000-1:100000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)IF : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66767-1-Ig targets HSP27 in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, zebrafish samples.

Tested Reactivity human, mouse, rat, zebrafish
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag27859

Product name: Recombinant human HSPB1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-205 aa of BC012768

Sequence: MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK

Predict reactive species
Full Name heat shock 27kDa protein 1
Calculated Molecular Weight 19-23 kDa
Observed Molecular Weight 27 kDa
GenBank Accession NumberBC012768
Gene Symbol HSPB1
Gene ID (NCBI) 3315
RRIDAB_2882113
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP04792
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HSPB1, also known as heat shock protein 27 (Hsp27), belongs to the small heat shock protein family which is induced in response to environmental challenges or/and developmental transitions. It is also an anti-apoptotic protein that plays crucial roles in tumorigenesis and cell survival and is reported to be an independent prognosis marker for cancer. Recently HSPB1 has been found to be a valuable marker for melanoma. In addition to the predicted 27 kDa, an extra 50-55 kDa representing dimeric form of HSPB1 may also be observed (21353161).

Protocols

Product Specific Protocols
WB protocol for HSP27 antibody 66767-1-IgDownload protocol
IHC protocol for HSP27 antibody 66767-1-IgDownload protocol
IF protocol for HSP27 antibody 66767-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

Hum Reprod

T-cadherin inhibits invasion and migration of endometrial stromal cells in endometriosis.

Authors - Qinsheng Lu
humanIF

Oncol Rep

SUMOylation of HSP27 regulates PKM2 to promote esophageal squamous cell carcinoma progression.

Authors - Xiao Zhang
mouse,humanWB,IF

Sci Adv

Reactive astrocytes secrete the chaperone HSPB1 to mediate neuroprotection

Authors - Fangjia Yang
Loading...
||
New chat Able
正在加载,请稍候...