HSP27 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• HSP27 Monoclonal antibody (66767-1-Ig)

• Featured Product
• KD/KO Validated

HSP27 Monoclonal Antibody for WB, IHC, IF, FC (Intra), ELISA

Cat No. 66767-1-Ig Copied!

Clone No. 3E7A1

Publications (10)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, zebrafish

Applications

WB, IHC, IF, FC (Intra), ELISA

Synonyms

HSPB1, 3E7A1, CMT2F, Estrogen-regulated 24 kDa protein, HMN2B

• 

  WB analysis using 66767-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66767-1-Ig (HSPB1 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 66767-1-Ig

  WB result of HSP27 antibody (66767-1-Ig; 1:60000; incubated at room temperature for 1.5 hours) with sh-Control and sh-HSP27 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HSC-T6 using 66767-1-Ig

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 66767-1-Ig (HSPB1 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 66767-1-Ig

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 66767-1-Ig (HSPB1 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 66767-1-Ig

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 66767-1-Ig (HSPB1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 66767-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66767-1-Ig (HSP27 antibody) at dilution of 1:8000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 66767-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using HSP27 antibody (66767-1-Ig, Clone: 3E7A1 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of zebrafish retina using 66767-1-Ig

  Antibody staining on tissue sections of the zebrafish retina at 5 days post fertilisation (dpf) for Heatshock protein 27 (Hsp27;magenta); (#66767-1-Ig) Dilution 1:200. Tissue fixed overnight in 4% PFA; DAPI, blue. Data generated by Natalia Jaroszynska in Professor Ryan MacDonald's lab, University College London, UK.

• 

  FC experiment of HepG2 using 66767-1-Ig

  1X10^6 HepG2 cells were intracellularly stained with 0.5 ug Anti-Human HSP27 (66767-1-Ig, Clone:3E7A1) (red) labeled with FlexAble CoraLite® Plus 555 Antibody Labeling Kit for Mouse IgG1 (KFA022), or 0.5 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for HSP27 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HCT 116 cells, HeLa cells, HSC-T6 cells, mouse liver tissue, U2OS cells, A549 cells, HepG2 cells, HuH-7 cells
• Positive IHC detected in: human gliomas tissue, human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF detected in: zebrafish retina, MCF-7 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:20000-1:100000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000
• Immunofluorescence (IF): IF : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66767-1-Ig targets HSP27 in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, zebrafish samples.

• Tested Reactivity: human, mouse, rat, zebrafish
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27859

  Product name: Recombinant human HSPB1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-205 aa of BC012768

  Sequence: MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK

• Full Name: heat shock 27kDa protein 1
• Calculated Molecular Weight: 19-23 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC012768
• Gene Symbol: HSPB1
• Gene ID (NCBI): 3315
• RRID: AB_2882113
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P04792
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HSPB1, also known as heat shock protein 27 (Hsp27), belongs to the small heat shock protein family which is induced in response to environmental challenges or/and developmental transitions. It is also an anti-apoptotic protein that plays crucial roles in tumorigenesis and cell survival and is reported to be an independent prognosis marker for cancer. Recently HSPB1 has been found to be a valuable marker for melanoma. In addition to the predicted 27 kDa, an extra 50-55 kDa representing dimeric form of HSPB1 may also be observed (21353161).

Publications

What published studies show

Anti-HSPB1 (HSP27) antibody, catalog #66767-1-Ig, has 10 total citations published in journals including Nature Communications, Science Advances, Drug Resistance Updates, Human Molecular Genetics, Oncology Reports, Cancer Immunology & Immunotherapy, International Immunopharmacology, Human Reproduction, PLoS One, and Shock. Associated research fields span oncology (cholangiocarcinoma, glioblastoma, esophageal carcinoma), neuroprotection, tumor immunology, reproductive biology, mitophagy in ulcerative colitis, bone regeneration, and intestinal barrier function.

Automatically generated from the 10 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC,IF	Drug Resist Updat; Targeting the USP5-HSPB1 axis overcomes ferroptosis resistance in intrahepatic cholangiocarcinoma.; Authors - Chengbin He
rat	WB	Nat Commun; Directed rescue strategy for enhanced implant osteointegration in aged rats.; Authors - Xuan Li
mouse,human	WB,IF	Sci Adv; Reactive astrocytes secrete the chaperone HSPB1 to mediate neuroprotection; Authors - Fangjia Yang
		Hum Reprod; T-cadherin inhibits invasion and migration of endometrial stromal cells in endometriosis.; Authors - Qinsheng Lu
mouse	IF	Cancer Immunol Immunother; Integrative analysis of single-cell and bulk transcriptome data reveals age-related immune cell alterations in primary glioblastoma associated with prognosis.; Authors - Zefan Jing
mouse,human	WB	Int Immunopharmacol; Targeting HSPB1 inhibits tumor growth and abrogates Treg-mediated tumor immunosuppression.; Authors - Qi Hu ; KO Validated