HSPC159 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83983-5-RR (same clone as 83983-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83983-5-RR (HSPC159 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83983-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83983-5-RR

  Biolayer interferometry (BLl) kinetic assays of 83983-5-RR against Human HSPC159 were performed. The affinity constant is 28 nM.

HSPC159 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 83983-5-PBS

Clone No.241113G5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Lectin galactoside-binding-like protein, GRP, Galectin-related protein, Galectin-like protein, galectin related protein

---

Product Information

83983-5-PBS targets HSPC159 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag10109

  Product name: Recombinant human HSPC159 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-172 aa of BC062691

  Sequence: MAGSVADSDAVVKLDDGHLNNSLSSPVQADVYFPRLIVPFCGHIKGGMRPGKKVLVMGIVDLNPESFAISLTCGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQPFRVEILCEHPRFRVFVDGHQLFDFYHRIQTLSAIDTIKINGDLQITKLG

• Full Name: galectin-related protein
• Calculated Molecular Weight: 172 aa, 19 kDa
• Observed Molecular Weight: 19 kDa
• GenBank Accession Number: BC062691
• Gene Symbol: HSPC159
• Gene ID (NCBI): 29094
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q3ZCW2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HSPC159 is a novel human galectin‐related protein (also known as GRP) that is mapped to human chromosome 2p13. The HSPC159 gene was originally deduced by partial sequence alignment and confirmed by a full‐length sequence for an mRNA isolated from CD34+ hematopoietic stem cells.