Use Able AI chat for product recommendations

HSPH1 Monoclonal antibody

HSPH1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66723-1-Ig
Clone No.3H5A5

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Antigen NY CO 25, DKFZp686M05240, Heat shock 110 kDa protein, Heat shock protein 105 kDa, HSP105, HSP105A, HSP105B, HSP110, HSPH1, KIAA0201, NY CO 25

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293 cells, MCF-7 cells, Jurkat cells
Positive IHC detected inmouse testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:20000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66723-1-Ig targets HSPH1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse samples.

Tested Reactivity Human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag27521

Product name: Recombinant human HSPH1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 508-858 aa of BC037553

Sequence: MSSEADMECLNQRPPENPDTDKNVQQDNSEAGTQPQVQTDAQQTSQSPPSPELTSEENKIPDADKANEKKVDQPPEAKKPKIKVVNVELPIEANLVWQLGKDLLNMYIETEGKMIMQDKLEKERNDAKNAVEEYVYEFRDKLCGPYEKFICEQDHQNFLRLLTETEDWLYEEGEDQAKQAYVDKLEELMKIGTPVKVRFQEAEERPKMFEELGQRLQHYAKIAADFRNKDEKYNHIDESEMKKVEKSVNEVMEWMNNVMNAQAKKSLDQDPVVRAQEIKTKIKELNNTCEPVVTQPKPKIESPKLERTPNGPNIDKKEEDLEDKNNFGAEPPHQNGECYPNEKNSVNMDLD

Predict reactive species
Full Name heat shock 105kDa/110kDa protein 1
Calculated Molecular Weight 858 aa, 97 kDa
Observed Molecular Weight 110 kDa
GenBank Accession NumberBC037553
Gene Symbol HSPH1
Gene ID (NCBI) 10808
RRIDAB_2882074
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ92598
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HSP105, also known as HSP110 or HSPH1, belongs to the heat shock protein (HSP) family. Human HSP105 is a high-molecular-weight chaperone protein expressed at constitutively low levels as a cytoplasmic α-isoform and as an inducible nuclear β-isoform on exposure to various forms of stress. HSP105 is constitutively overexpressed in several solid tumors, including melanoma, breast, thyroid, and gastroenteric cancers, and exerts antiapoptotic functions. Recently HSP105 has been identified as a novel candidate biomarker of lymphoma aggressiveness. Western blot analysis using this antibody detected the phosphorylated protein around 110 kDa in various lysates.

Protocols

Product Specific Protocols
IF protocol for HSPH1 antibody 66723-1-IgDownload protocol
IHC protocol for HSPH1 antibody 66723-1-IgDownload protocol
WB protocol for HSPH1 antibody 66723-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...