CoraLite®594-conjugated HSPH1 Monoclonal antibody

HSPH1 Monoclonal Antibody for IF/ICC

Cat No. CL594-66723
Clone No.3H5A5

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

IF/ICC

Antigen NY CO 25, DKFZp686M05240, Heat shock 110 kDa protein, Heat shock protein 105 kDa, HSP105, HSP105A, HSP105B, HSP110, HSPH1, KIAA0201, NY CO 25

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66723 targets HSPH1 in IF/ICC applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag27521

Product name: Recombinant human HSPH1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 508-858 aa of BC037553

Sequence: MSSEADMECLNQRPPENPDTDKNVQQDNSEAGTQPQVQTDAQQTSQSPPSPELTSEENKIPDADKANEKKVDQPPEAKKPKIKVVNVELPIEANLVWQLGKDLLNMYIETEGKMIMQDKLEKERNDAKNAVEEYVYEFRDKLCGPYEKFICEQDHQNFLRLLTETEDWLYEEGEDQAKQAYVDKLEELMKIGTPVKVRFQEAEERPKMFEELGQRLQHYAKIAADFRNKDEKYNHIDESEMKKVEKSVNEVMEWMNNVMNAQAKKSLDQDPVVRAQEIKTKIKELNNTCEPVVTQPKPKIESPKLERTPNGPNIDKKEEDLEDKNNFGAEPPHQNGECYPNEKNSVNMDLD

Predict reactive species
Full Name heat shock 105kDa/110kDa protein 1
Calculated Molecular Weight 858 aa, 97 kDa
Observed Molecular Weight 110 kDa
GenBank Accession NumberBC037553
Gene Symbol HSPH1
Gene ID (NCBI) 10808
RRIDAB_2883618
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ92598
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

HSP105, also known as HSP110 or HSPH1, belongs to the heat shock protein (HSP) family. Human HSP105 is a high-molecular-weight chaperone protein expressed at constitutively low levels as a cytoplasmic α-isoform and as an inducible nuclear β-isoform on exposure to various forms of stress. HSP105 is constitutively overexpressed in several solid tumors, including melanoma, breast, thyroid, and gastroenteric cancers, and exerts antiapoptotic functions. Recently HSP105 has been identified as a novel candidate biomarker of lymphoma aggressiveness. Western blot analysis using this antibody detected the phosphorylated protein around 110 kDa in various lysates.

Protocols

Product Specific Protocols
IF protocol for CL594 HSPH1 antibody CL594-66723Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...