HTR4 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• HTR4 Recombinant monoclonal antibody, PBS Only (85083-3-PBS)

HTR4 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85083-3-PBS

Clone No.242771E8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

5 HT 4, 5 HT4, 5 HT4R, 5 hydroxytryptamine receptor 4, 5-HT4

• 

  WB analysis using 85083-3-RR (same clone as 85083-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85083-3-RR (HTR4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85083-3-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

85083-3-PBS targets HTR4 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag15226

  Product name: Recombinant human HTR4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 301-388 aa of BC074755

  Sequence: GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRDAVECGGQWESQCHPPATSPLVAAQPSDT

• Full Name: 5-hydroxytryptamine (serotonin) receptor 4
• Calculated Molecular Weight: 388 aa, 44 kDa
• Observed Molecular Weight: ~45 kDa
• GenBank Accession Number: BC074755
• Gene Symbol: HTR4
• Gene ID (NCBI): 3360
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13639
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HTR4 (5-hydroxytryptamine receptor 4, 5-HT4) is a G protein-coupled receptor (GPCR) belonging to the serotonin receptor family. Activated by the neurotransmitter serotonin (5-hydroxytryptamine, 5-HT), HTR4 primarily couples to Gs proteins, leading to stimulation of adenylyl cyclase, increased intracellular cAMP levels, and activation of downstream signaling pathways. HTR4 is widely expressed in the gastrointestinal tract, central nervous system, and cardiovascular system, where it regulates gastrointestinal motility, neurotransmission, learning and memory, and cardiac function. In the nervous system, HTR4 has been implicated in cognitive processes and neuroprotection, while in the gut it promotes intestinal peristalsis and secretion.