HTR4 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• HTR4 Recombinant monoclonal antibody (85083-3-RR)

HTR4 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 85083-3-RR

Clone No.242771E8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

5 HT 4, 5 HT4, 5 HT4R, 5 hydroxytryptamine receptor 4, 5-HT4

• 

  WB analysis using 85083-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 85083-3-RR (HTR4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

85083-3-RR targets HTR4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag15226

  Product name: Recombinant human HTR4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 301-388 aa of BC074755

  Sequence: GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRDAVECGGQWESQCHPPATSPLVAAQPSDT

• Full Name: 5-hydroxytryptamine (serotonin) receptor 4
• Calculated Molecular Weight: 388 aa, 44 kDa
• Observed Molecular Weight: ~45 kDa
• GenBank Accession Number: BC074755
• Gene Symbol: HTR4
• Gene ID (NCBI): 3360
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13639
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HTR4 (5-hydroxytryptamine receptor 4, 5-HT4) is a G protein-coupled receptor (GPCR) belonging to the serotonin receptor family. Activated by the neurotransmitter serotonin (5-hydroxytryptamine, 5-HT), HTR4 primarily couples to Gs proteins, leading to stimulation of adenylyl cyclase, increased intracellular cAMP levels, and activation of downstream signaling pathways. HTR4 is widely expressed in the gastrointestinal tract, central nervous system, and cardiovascular system, where it regulates gastrointestinal motility, neurotransmission, learning and memory, and cardiac function. In the nervous system, HTR4 has been implicated in cognitive processes and neuroprotection, while in the gut it promotes intestinal peristalsis and secretion.