HTR5A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• HTR5A Polyclonal antibody, PBS Only (28221-1-PBS)

• 

  IHC staining of mouse brain using 28221-1-AP (same clone as 28221-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28221-1-AP (HTR5A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28221-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 28221-1-AP (same clone as 28221-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28221-1-AP (HTR5A antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28221-1-PBS in a different storage buffer formulation.

HTR5A Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 28221-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

28221-1-PBS targets HTR5A in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28177

  Product name: Recombinant human HTR5A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 182-282 aa of BC112021

  Sequence: GETYSEGSEECQVSREPSYAVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVSPISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQR

• Full Name: 5-hydroxytryptamine (serotonin) receptor 5A
• Calculated Molecular Weight: 357 aa, 48 kDa
• GenBank Accession Number: BC112021
• Gene Symbol: HTR5A
• Gene ID (NCBI): 3361
• RRID: AB_2918151
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P47898
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.