Home
Products
Primary Antibodies
HTR6 Polyclonal antibody, PBS Only (23561-1-PBS)

Filter: AllIHCIF-P

IHC staining of human brain using 23561-1-AP (same clone as 23561-1-PBS)
Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 23561-1-AP (HTR6 Antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 23561-1-PBS in a different storage buffer formulation.
IHC staining of human brain using 23561-1-AP (same clone as 23561-1-PBS)
Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 23561-1-AP (HTR6 Antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 23561-1-PBS in a different storage buffer formulation.
IF Staining of mouse brain using 23561-1-AP (same clone as 23561-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using HTR6 antibody (23561-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 23561-1-PBS in a different storage buffer formulation.
IF Staining of mouse brain using 23561-1-AP (same clone as 23561-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using HTR6 antibody (23561-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 23561-1-PBS in a different storage buffer formulation.
IF Staining of rat brain using 23561-1-AP (same clone as 23561-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed rat brain tissue using HTR6 antibody (23561-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 23561-1-PBS in a different storage buffer formulation.
IF Staining of rat brain using 23561-1-AP (same clone as 23561-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed rat brain tissue using HTR6 antibody (23561-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 23561-1-PBS in a different storage buffer formulation.

HTR6 Polyclonal antibody, PBS Only

Name: HTR6 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 23561-1-PBS

HTR6 Polyclonal Antibody for IHC, IF-P, Indirect ELISA

Cat No. 23561-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF-P, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

23561-1-PBS targets HTR6 in IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag15396 Product name: Recombinant human HTR6 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 311-440 aa of BC074996 Sequence: CNSTMNPIIYPLFMRDFKRALGRFLPCPRCPRERQASLASPSLRTSHSGPRPGLSLQQVLPLPLPPDSDSDSDAGSGGSSGLRLTAQLLLPGEATQDPPLPTRAAAAVNFFNIDPAEPELRPHPLGIPTN Predict reactive species
Full Name	5-hydroxytryptamine (serotonin) receptor 6
Calculated Molecular Weight	440 aa, 47 kDa
GenBank Accession Number	BC074996
Gene Symbol	HTR6
Gene ID (NCBI)	3362
RRID	AB_2879296
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen Affinity purified
UNIPROT ID	P50406
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.