HVCN1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• HVCN1 Polyclonal antibody, PBS Only (14162-1-PBS)

• 

  WB analysis of Raji using 14162-1-AP (same clone as 14162-1-PBS)

  Raji cells were subjected to SDS PAGE followed by western blot with 14162-1-AP (HVCN1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14162-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 14162-1-AP (same clone as 14162-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 14162-1-AP (HVCN1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14162-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Raji using 14162-1-AP (same clone as 14162-1-PBS)

  Raji cells were subjected to SDS PAGE followed by western blot with 14162-1-AP (HVCN1 Antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14162-1-PBS in a different storage buffer formulation.

• 

  IP experiment of PC-3 using 14162-1-AP (same clone as 14162-1-PBS)

  IP result of anti-HVCN1 (IP:14162-1-AP, 4ug; Detection:14162-1-AP 1:300) with PC-3 cells lysate 4000 ug. This data was developed using the same antibody clone with 14162-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 14162-1-AP (same clone as 14162-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 14162-1-AP (HVCN1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14162-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 14162-1-AP (same clone as 14162-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 14162-1-AP (HVCN1 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 14162-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 14162-1-AP (same clone as 14162-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 14162-1-AP (HVCN1 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 14162-1-PBS in a different storage buffer formulation.

• 

  IF Staining of PC-3 using 14162-1-AP (same clone as 14162-1-PBS)

  Immunofluorescent analysis of (-20℃ Ethanol) fixed PC-3 cells using 14162-1-AP (HVCN1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 14162-1-PBS in a different storage buffer formulation.

HVCN1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 14162-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

VSOP, Voltage-gated hydrogen channel 1, Voltage sensor domain-only protein, UNQ578/PRO1140, Hydrogen voltage-gated channel 1

---

Product Information

14162-1-PBS targets HVCN1 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5350

  Product name: Recombinant human HVCN1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-103 aa of BC032672

  Sequence: MATWDEKAVTRRAKVAPAERMSKFLRHFTVVGDDYHAWNINYKKWENEEEEEEEEQPPPTPVSGEEGRAAAPDVAPAPGPAPRAPLDFRGMLRKLFSSHRFQV

• Full Name: hydrogen voltage-gated channel 1
• Calculated Molecular Weight: 273 aa, 32 kDa
• Observed Molecular Weight: 28-32 kDa, ~60 kDa
• GenBank Accession Number: BC032672
• Gene Symbol: HVCN1
• Gene ID (NCBI): 84329
• RRID: AB_2878023
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96D96
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HVCN1, also named as VSOP and HV1, Belongs to the hydrogen channel family. HVCN1 mediates the voltage-dependent proton permeability of excitable membranes. It forms a proton-selective channel through which protons may pass in accordance with their electrochemical gradient. Proton efflux, HVCN1 is accompanied by membrane depolarization, facilitates acute production of reactive oxygen species in phagocytosis. HVCN1, the voltage-sensitive proton channel, is present in human sperm and is an important regulator of the functional maturation of sperm. HVCN1 has four isoforms with MW 28-32 kDa or 40 kDa (modification). It has a dimer form with MW ~60 kDa.