HYAL1 Monoclonal antibody, PBS Only

HYAL1 Monoclonal Antibody for WB, Indirect ELISA
Cat No. 66560-1-PBS
Clone No.1B8B5

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, Indirect ELISA

1B8B5, EC:3.2.1.35, HYAL 1, Hyal-1, Hyaluronidase 1

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66560-1-PBS targets HYAL1 in WB, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag18183

Product name: Recombinant human HYAL1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 131-435 aa of BC035695

Sequence: EAWRPRWAFNWDTKDIYRQRSRALVQAQHPDWPAPQVEAVAQDQFQGAARAWMAGTLQLGRALRPRGLWGFYGFPDCYNYDFLSPNYTGQCPSGIRAQNDQLGWLWGQSRALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAAGDPNLPVLPYVQIFYDTTNHFLPLDELEHSLGESAAQGAAGVVLWVSWENTRTKESCQAIKEYMDTTLGPFILNVTSGALLCSQALCSGHGRCVRRTSHPKALLLLNPASFSIQLTPGGGPLSLRGALSLEDQAQMAVEFKCRCYPGWQAPWCERKSMW

Predict reactive species
Full Name hyaluronoglucosaminidase 1
Calculated Molecular Weight 435 aa, 48 kDa
Observed Molecular Weight 60 kDa
GenBank Accession NumberBC035695
Gene Symbol HYAL1
Gene ID (NCBI) 3373
RRIDAB_2881921
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ12794
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Hyaluronic acid (HA) is a glycosaminoglycan that is believed to have numerous important biologic functions, including modulation of cell proliferation, migration, and differentiation, as well as the regulation of extracellular water and protein homeostasis. It is also an integral structural component of cartilage and other tissues and acts as a lubricant in joints. Hyaluronidases are a family of enzymes that catalyse the degradation of HA. In humans, there are five functional hyaluronidases: HYAL1, HYAL2, HYAL3, HYAL4 and HYAL5 (also known as SPAM1 or PH-20); plus a pseudogene, HYAL6 (also known as HYALP1). HYAL-1 is present in many tissues and is predominantly found in the plasma and urine (PMID: 16600643). In addition to its function in normal cellular hyaluronan turnover, human HYAL-1 is implicated in cancer proliferation, angiogenesis, and inflammatory diseases (PMID: 17503783).

Loading...
||
New chat Able
正在加载,请稍候...