HYAL3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• HYAL3 Polyclonal antibody, PBS Only (19625-1-PBS)

• 

  WB analysis of human brain using 19625-1-AP (same clone as 19625-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 19625-1-AP (HYAL3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 19625-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 19625-1-AP (same clone as 19625-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 19625-1-AP (HYAL3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 19625-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 19625-1-AP (same clone as 19625-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 19625-1-AP (HYAL3 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 19625-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 19625-1-AP (same clone as 19625-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 19625-1-AP (HYAL3 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 19625-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 19625-1-AP (same clone as 19625-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 19625-1-AP (HYAL3 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 19625-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 19625-1-AP (same clone as 19625-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 19625-1-AP (HYAL3 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 19625-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 19625-1-AP (same clone as 19625-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 19625-1-AP (HYAL3 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 19625-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 19625-1-AP (same clone as 19625-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 19625-1-AP (HYAL3 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 19625-1-PBS in a different storage buffer formulation.

HYAL3 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 19625-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

19625-1-PBS targets HYAL3 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8611

  Product name: Recombinant human HYAL3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-350 aa of BC005896

  Sequence: MTTQLGPALVLGVALCLGCGQPLPQVPERPFSVLWNVPSAHCEARFGVHLPLNSLGIIANRGQHFHGQNMTIFYKNQLGLYPYFGPRGTAHNGGIPQALPLDRHLALAAYQIHHSLRPGFAGPAVLDWEEWCPLWAGNWGRRRAYQAASWAWAQQVFPDLDPQEQLYKAYTGFEQAARALMEDTLRVAQALRPHGLWGFYHYPACGNGWHSMASNYTGRCHAATLARNTQLHWLWAASSALFPSIYLPPRLPPAHHQAFVRHRLEEAFRVALVGHRHPLPVLAYVRLTHRRSGRFLSQDDLVQSIGVSAALGAAGVVLWGDLSLSSSEEECWHLHDYLVDTLGPYVINVT

• Full Name: hyaluronoglucosaminidase 3
• Calculated Molecular Weight: 417aa,47 kDa; 463aa,52 kDa
• Observed Molecular Weight: 47 kDa, 55 kDa
• GenBank Accession Number: BC005896
• Gene Symbol: HYAL3
• Gene ID (NCBI): 8372
• RRID: AB_10666437
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43820
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.