Rat KIM-1/HAVCR1 Recombinant monoclonal antibody, PBS Only

KIM-1/HAVCR1 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 83221-2-PBS
Clone No.230528C5

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, Cytometric bead array, Indirect ELISA

HAVCR1, KIM-1, TIM-1, 230528C5, CD365

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83221-2-PBS targets KIM-1/HAVCR1 in WB, Cytometric bead array, Indirect ELISA applications and shows reactivity with mouse, rat samples.

Tested Reactivity mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0597

Product name: Recombinant Rat KIM-1/HAVCR1 protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 18-238 aa of NM_173149.2

Sequence: SVDSYEVVKGVVGHPVTIPCTYSTRGGITTTCWGRGQCPYSSCQNILIWTNGYQVTYRSSGRYNIKGRISEGDVSLTIENSVDSDSGLYCCRVEIPGWFNDQKMTFSLEVKPEIPTSPPTRPTTTRPTTTRPTTISTRSTHVPTSTRVSTSTPTPEQTQTHKPEITTFYAHETTAEVTETPSYTPADWNGTVTSSEEAWNNHTVRIPLRKPQRNPTKGFYV

Predict reactive species
Full Name hepatitis A virus cellular receptor 1
Calculated Molecular Weight34 kDa
Observed Molecular Weight72 kDa
GenBank Accession NumberNM_173149.2
Gene Symbol Havcr1
Gene ID (NCBI) 286934
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO54947
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Kidney injury molecule 1 (KIM-1), also known as Hepatitis A virus cellular receptor 1 (HAVCR1), CD365, or T-cell immunoglobulin and mucin domain 1 (TIM-1), is a class I integral membrane glycoprotein, with an ectodomain containing Ig-like domain and a mucin domain. KIM-1 acts as a membrane receptor for hepatitis A virus (HAV) (PMID: 9658108; 8861957). KIM-1 provides a costimulatory signal for T cell activation and inhibits the development of peripheral tolerance (PMID: 16284246; 15793575). KIM-1 may be involved in the regulation of asthma and allergic diseases (PMID: 14534576). It has been reported that KIM-1 is shed into urine after acute kidney damage and is a marker of renal tubular injury (PMID: 14600030).

Loading...
||
New chat Able
正在加载,请稍候...