Rat KIM-1/HAVCR1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83221-2-RR (same clone as 83221-2-PBS)

  Mouse kidney tissue was subjected to SDS PAGE followed by western blot with 83221-2-RR (HAVCR1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83221-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83221-2-RR

  Biolayer interferometry (BLl) kinetic assays of 83221-2-RR against Rat HAVCR1 were performed. The affinity constant is 0.477 nM.

KIM-1/HAVCR1 Uni-rAb^® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 83221-2-PBS

Clone No.230528C5

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, Cytometric bead array, Indirect ELISA

Synonyms

HAVCR1, KIM-1, TIM-1, 230528C5, CD365

---

Product Information

83221-2-PBS targets KIM-1/HAVCR1 in WB, Cytometric bead array, Indirect ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0597

  Product name: Recombinant Rat KIM-1/HAVCR1 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 18-238 aa of NM_173149.2

  Sequence: SVDSYEVVKGVVGHPVTIPCTYSTRGGITTTCWGRGQCPYSSCQNILIWTNGYQVTYRSSGRYNIKGRISEGDVSLTIENSVDSDSGLYCCRVEIPGWFNDQKMTFSLEVKPEIPTSPPTRPTTTRPTTTRPTTISTRSTHVPTSTRVSTSTPTPEQTQTHKPEITTFYAHETTAEVTETPSYTPADWNGTVTSSEEAWNNHTVRIPLRKPQRNPTKGFYV

• Full Name: hepatitis A virus cellular receptor 1
• Calculated Molecular Weight: 34 kDa
• Observed Molecular Weight: 72 kDa
• GenBank Accession Number: NM_173149.2
• Gene Symbol: Havcr1
• Gene ID (NCBI): 286934
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O54947
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Kidney injury molecule 1 (KIM-1), also known as Hepatitis A virus cellular receptor 1 (HAVCR1), CD365, or T-cell immunoglobulin and mucin domain 1 (TIM-1), is a class I integral membrane glycoprotein, with an ectodomain containing Ig-like domain and a mucin domain. KIM-1 acts as a membrane receptor for hepatitis A virus (HAV) (PMID: 9658108; 8861957). KIM-1 provides a costimulatory signal for T cell activation and inhibits the development of peripheral tolerance (PMID: 16284246; 15793575). KIM-1 may be involved in the regulation of asthma and allergic diseases (PMID: 14534576). It has been reported that KIM-1 is shed into urine after acute kidney damage and is a marker of renal tubular injury (PMID: 14600030).