Histone H1.0 Recombinant monoclonal antibody, PBS Only (Detector)

Histone H1.0 Uni-rAb® Recombinant Antibody for WB, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 83993-1-PBS
Clone No.241147D2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

H1F0, 241147D2, H1 histone family, member 0, H10, H1-0

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83993-1-PBS targets Histone H1.0 as part of a matched antibody pair:

MP00895-1: 83993-3-PBS capture and 83993-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag9982

Product name: Recombinant human Histone H1.0 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-194 aa of BC000145

Sequence: MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK

Predict reactive species
Full Name H1 histone family, member 0
Calculated Molecular Weight 21 kDa
Observed Molecular Weight 32 kDa
GenBank Accession NumberBC000145
Gene Symbol Histone H1.0
Gene ID (NCBI) 3005
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP07305
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. Linker histones are involved in forming higher order structure in chromatin and maintaining overall chromatin compaction. The H1F0 histones are found in cells that are in terminal stages of differentiation or that have low rates of cell division.Histone H1.0 (H1F0,H1FV) is a linker histone that is widely expressed in many tissues and almost all vertebrates, unlike some other linker histones. The observed molecular weight of H1F0 is about 32 kDa.

Loading...
||
New chat Able
正在加载,请稍候...