Histone H1.0 Recombinant monoclonal antibody

Histone H1.0 Uni-rAb® Recombinant Antibody for WB, FC (Intra), ELISA
Cat No. 83993-1-RR
Clone No.241147D2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, FC (Intra), ELISA

H1F0, H1FV, H1-0, H10, H1 histone family, member 0

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, NIH/3T3 cells, HEK-29 cells, A431 cells, C6 cells, mouse testis tissue, rat spleen tissue
Positive FC (Intra) detected inBxPC-3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83993-1-RR targets Histone H1.0 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag9982

Product name: Recombinant human Histone H1.0 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-194 aa of BC000145

Sequence: MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK

Predict reactive species
Full Name H1 histone family, member 0
Calculated Molecular Weight 21 kDa
Observed Molecular Weight 32 kDa
GenBank Accession NumberBC000145
Gene Symbol Histone H1.0
Gene ID (NCBI) 3005
RRIDAB_3671568
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP07305
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. Linker histones are involved in forming higher order structure in chromatin and maintaining overall chromatin compaction. The H1F0 histones are found in cells that are in terminal stages of differentiation or that have low rates of cell division.Histone H1.0 (H1F0,H1FV) is a linker histone that is widely expressed in many tissues and almost all vertebrates, unlike some other linker histones. The observed molecular weight of H1F0 is about 32 kDa.

Protocols

Product Specific Protocols
WB protocol for Histone H1.0 antibody 83993-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...