Histone H2B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Histone H2B Polyclonal antibody, PBS Only (15857-1-PBS)

• 

  WB analysis using 15857-1-AP (same clone as 15857-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 15857-1-AP (Histone H2B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15857-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 15857-1-AP (same clone as 15857-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15857-1-AP (Histone H2B antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15857-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse pancreas using 15857-1-AP (same clone as 15857-1-PBS)

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 15857-1-AP (Histone H2B Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15857-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat kidney using 15857-1-AP (same clone as 15857-1-PBS)

  rat kidney tissue were subjected to SDS PAGE followed by western blot with 15857-1-AP (Histone H2B Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15857-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293 using 15857-1-AP (same clone as 15857-1-PBS)

  IP result of anti-Histone H2B (IP:15857-1-AP, 4ug; Detection:15857-1-AP 1:500) with HEK-293 cells lysate 2000ug. This data was developed using the same antibody clone with 15857-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 15857-1-AP (same clone as 15857-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 15857-1-AP (Histone H2B antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15857-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 15857-1-AP (same clone as 15857-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 15857-1-AP (Histone H2B antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15857-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 15857-1-AP (same clone as 15857-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 15857-1-AP (Histone H2B Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 15857-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 15857-1-AP (same clone as 15857-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 15857-1-AP (Histone H2B Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 15857-1-PBS in a different storage buffer formulation.

• 

  IF Staining using 15857-1-AP (same clone as 15857-1-PBS)

  Mouse tumour sections were labelled with H2B (15857-1-AP, red), Dendra2 (green), and DAPI. The image was credited by Dr. Hae Lin Jang from Harvard Medical School. This data was developed using the same antibody clone with 15857-1-PBS in a different storage buffer formulation.

Histone H2B Polyclonal Antibody for WB, IHC, IF, IP, Indirect ELISA

Cat No. 15857-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, Indirect ELISA

Synonyms

HIST2H2BE, GL105, H2B, H2B.1, H2B/q

---

Product Information

15857-1-PBS targets Histone H2B in WB, IHC, IF, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7811

  Product name: Recombinant human Histone H2B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-126 aa of BC005827

  Sequence: MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

• Full Name: histone cluster 2, H2be
• Calculated Molecular Weight: 14 kDa
• Observed Molecular Weight: 14-17 kDa
• GenBank Accession Number: BC005827
• Gene Symbol: Histone H2B
• Gene ID (NCBI): 8349
• RRID: AB_10664929
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16778
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Histone H2B is a core component of the nucleosome, the fundamental unit of chromatin. It forms a dimer with Histone H2A, and two H2A-H2B dimers combine with a (H3-H4)₂ tetramer to create the histone octamer. The primary function of this structure is to package DNA into a compact and manageable form. However, H2B is also subject to various post-translational modifications (PTMs), such as ubiquitination, which serve as epigenetic marks to regulate gene expression by altering chromatin accessibility.