Histone H2B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Histone H2B Polyclonal antibody, PBS Only (33612-1-PBS)

• 

  WB analysis using 33612-1-AP (same clone as 33612-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33612-1-AP (Histone H2B antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33612-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 33612-1-AP (same clone as 33612-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33612-1-AP (HIST1H2BD antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33612-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 33612-1-AP (same clone as 33612-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 33612-1-AP (Histone H2B antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 33612-1-PBS in a different storage buffer formulation.

Histone H2B Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 33612-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

H2B, H2B/a, H2B/g, H2B/h, H2B/k

---

Product Information

33612-1-PBS targets Histone H2B in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38954

  Product name: Recombinant human HIST1H2BD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-126 aa of NM_021063.3

  Sequence: MPEPTKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

• Full Name: histone cluster 1, H2bd
• Calculated Molecular Weight: 14kDa，126aa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: NM_021063.3
• Gene Symbol: HIST1H2BD
• Gene ID (NCBI): 3017
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P58876
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Histone H2B is a core component of the nucleosome, the fundamental unit of chromatin. It forms a dimer with Histone H2A, and two H2A-H2B dimers combine with a (H3-H4)₂ tetramer to create the histone octamer. The primary function of this structure is to package DNA into a compact and manageable form. However, H2B is also subject to various post-translational modifications (PTMs), such as ubiquitination, which serve as epigenetic marks to regulate gene expression by altering chromatin accessibility.