Tested Applications
| Positive WB detected in | HeLa cells, A549 cells, mouse brain tissue, mouse kidney tissue, mouse skeletal muscle tissue, rat brain tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HepG2 cells |
| Positive ChIP-qPCR detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| CHIP-QPCR | CHIP-QPCR : 1:10-1:100 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
81984-2-RR targets Histone H3 in WB, IHC, IF/ICC, FC (Intra), ELISA, ChIP-qPCR applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag10644 Product name: Recombinant human Histone-H3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-136 aa of BC015544 Sequence: MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA Predict reactive species |
| Full Name | histone cluster 2, H3a |
| Calculated Molecular Weight | 136 aa, 15 kDa |
| Observed Molecular Weight | 15-17 kDa |
| GenBank Accession Number | BC015544 |
| Gene Symbol | Histone H3 |
| Gene ID (NCBI) | 333932 |
| RRID | AB_3670510 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | Q71DI3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Histone-H3, histone cluster 2, H3a is the core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machinery which requires DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Histone-H3 is expressed during S phase; then expression strongly decreases as cell division slows down during the process of differentiation.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Histone H3 antibody 81984-2-RR | Download protocol |
| IHC protocol for Histone H3 antibody 81984-2-RR | Download protocol |
| WB protocol for Histone H3 antibody 81984-2-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Histone H3 Recombinant monoclonal antibody (241079B2), catalog number 81984-2-RR, has 7 citations. These appear in journals including Cancer Cell, Oncogene, Redox Biology Reports, European Journal of Medicinal Chemistry, Clinical Epigenetics, Journal of Molecular Neuroscience, and Neuroscience Letters. Research fields span colorectal cancer, bladder cancer metastasis, pulmonary fibrosis and ferroptosis, triple-negative breast cancer, sepsis-related metabolic reprogramming, glioblastoma biomarkers, and neuroinflammation with microglial activation.
| Species | Application | Title |
|---|---|---|
Cancer Cell Candida albicans synergizes with Fusobacterium nucleatum in colorectal cancer progression via the Flo9-RadD interaction. | ||
Oncogene Non-classic deubiquitinase USP13 inhibits bladder cancer metastasis through destabilizing cytoplasmic KDM3A. | ||
Redox Rep Prophylactic quercetin administration attenuates pulmonary fibrosis via ferroptosis-resistant priming of alveolar epithelial cells. | ||
Eur J Med Chem Discovery of a potent PROTAC targeting G9a suppresses proliferation of triple-negative breast cancer cells and psoriasis-like keratinocytes. | ||
Clin Epigenetics Hexokinase 3 promoted cytokine production of monocytes by targeting metabolic reprogramming and histone lactylation in sepsis. | ||
J Mol Neurosci Decoding EGFR A289 Mutation in Glioblastoma: A Predictive Biomarker Framework and Targeted Therapeutic Insights |
