Huntingtin Polyclonal antibody

Huntingtin Polyclonal Antibody for IHC, IF-P, ELISA
Cat No. 27206-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF-P, ELISA

HTT, HD, HD protein, Huntingtin, myristoylated N-terminal fragment, Huntington disease protein

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman cerebellum tissue, human brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inrat cerebellum tissue, mouse brain tissue

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

27206-1-AP targets Huntingtin in IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25922

Product name: Recombinant human Huntingtin protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 2845-3000 aa of NM_002111

Sequence: LDVGPEFSASIIQMCGVMLSGSEESTPSIIYHCALRGLERLLLSEQLSRLDAESLVKLSVDRVNVHSPHRAMAALGLMLTCMYTGKEKVSPGRTSDPNPAAPDSESVIVAMERVSVLFDRIRKGFPCEARVVARILPQFLDDFFPPQDIMNKVIGE

Predict reactive species
Full Name huntingtin
Calculated Molecular Weight 348 kDa
GenBank Accession NumberNM_002111
Gene Symbol Huntingtin
Gene ID (NCBI) 3064
RRIDAB_2880799
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP42858
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HTT(huntingtin), also named HD and IT15, belongs to the huntingtin family. HTT may play a role in microtubule-mediated transport or vesicle function. Defects in HTT are the cause of Huntington's disease (HD) which is an autosomal dominant neurodegenerative disorder characterized by involuntary movements (chorea), general motor impairment, psychiatric disorders, and dementia.

Protocols

Product Specific Protocols
IF protocol for Huntingtin antibody 27206-1-APDownload protocol
IHC protocol for Huntingtin antibody 27206-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Florian (Verified Customer) (03-22-2024)

Primary antibody was tested for ICC, where no specific signal was observed. The antibody therefore was not able to specifically stain Huntingtin aggregates. We then also proceeded to detection of a WB, which resulted in a strong non-specific band. As the theoretical epitope of this antibody is of great interest for us, we would be very looking forward for improvements in this regard.

  • Applications: Western Blot, Immunofluorescence
  • Cell Tissue Type: HEK293T
Loading...
||
New chat Able
正在加载,请稍候...