CoraLite® Plus 488-conjugated Huntingtin Polyclonal antibody

Huntingtin Polyclonal Antibody for IF/ICC
Cat No. CL488-27206

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

HD, HD protein, HTT, huntingtin, Huntington disease protein, IT15

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inSH-SY5Y cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-27206 targets Huntingtin in IF/ICC applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25922

Product name: Recombinant human Huntingtin protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 2845-3000 aa of NM_002111

Sequence: LDVGPEFSASIIQMCGVMLSGSEESTPSIIYHCALRGLERLLLSEQLSRLDAESLVKLSVDRVNVHSPHRAMAALGLMLTCMYTGKEKVSPGRTSDPNPAAPDSESVIVAMERVSVLFDRIRKGFPCEARVVARILPQFLDDFFPPQDIMNKVIGE

Predict reactive species
Full Name huntingtin
Calculated Molecular Weight 348 kDa
GenBank Accession NumberNM_002111
Gene Symbol Huntingtin
Gene ID (NCBI) 3064
RRIDAB_3084108
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP42858
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

HTT(huntingtin), also named as HD and IT15, belongs to the huntingtin family. HTT may play a role in microtubule-mediated transport or vesicle function. Defects in HTT are the cause of Huntington disease (HD) which is an autosomal dominant neurodegenerative disorder characterized by involuntary movements (chorea), general motor impairment, psychiatric disorders and dementia.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 Huntingtin antibody CL488-27206Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...