IAH1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• IAH1 Polyclonal antibody, PBS Only (17808-1-PBS)

• 

  WB analysis of mouse testis using 17808-1-AP (same clone as 17808-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 17808-1-AP (IAH1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17808-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 17808-1-AP (same clone as 17808-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 17808-1-AP (IAH1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17808-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse kidney using 17808-1-AP (same clone as 17808-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 17808-1-AP (IAH1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17808-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse kidney using 17808-1-AP (same clone as 17808-1-PBS)

  IP result of anti-IAH1 (IP:17808-1-AP, 3ug; Detection:17808-1-AP 1:500) with mouse kidney tissue lysate 5000ug. This data was developed using the same antibody clone with 17808-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse testis using 17808-1-AP (same clone as 17808-1-PBS)

  IP result of anti-IAH1 (IP:17808-1-AP, 3ug; Detection:17808-1-AP 1:500) with mouse testis tissue lysate 4800ug. This data was developed using the same antibody clone with 17808-1-PBS in a different storage buffer formulation.

IAH1 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 17808-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

---

Product Information

17808-1-PBS targets IAH1 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12089

  Product name: Recombinant human IAH1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-248 aa of BC111025

  Sequence: MALCEAAGCGSALLWPRLLLFGDSITQFSFQQGGWGASLADRLVRKCDVLNRGFSGYNTRWAKIILPRLIRKGNSLDIPVAVTIFFGANDSALKDENPKQHIPLEEYAANLKSMVQYLKSVDIPENRVILITPTPLCETAWEEQCIIQGCKLNRLNSVVGEYANACLQVAQDCGTDVLDLWTLMQDSQDFSSYLSDGLHLSPKGNEFLFSHLWPLIEKKVSSLPLLLPYWRDVAEAKPELSLLGDGDH

• Full Name: isoamyl acetate-hydrolyzing esterase 1 homolog (S. cerevisiae)
• Calculated Molecular Weight: 248 aa, 28 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC111025
• Gene Symbol: IAH1
• Gene ID (NCBI): 285148
• RRID: AB_2123524
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q2TAA2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.