• Zero Fc receptor binding
  • Site-specific conjugation
  • One universal isotype

FcZero-rAb® APC Anti-Human ICAM-1/CD54 Rabbit Recombinant Antibody

ICAM-1/CD54 FcZero-rAb® Recombinant Antibody for FC
Cat No. APC-FcA98011
Clone No.240646A11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

CD54, ICAM-1, 240646A11, BB2, ICAM 1

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Conjugate:  APC
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inhuman PBMCs

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 5 ul per 10^6 cells in 100 μl suspension
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.
Sample-dependent, Check data in validation data gallery.

Product Information

APC-FcA98011 targets ICAM-1/CD54 in FC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0570

Product name: Recombinant Human ICAM-1/CD54 protein (His Tag)(HPLC verified)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 28-480 aa of BC015969

Sequence: QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE

Predict reactive species
Full Name intercellular adhesion molecule 1
Calculated Molecular Weight 90 kDa
GenBank Accession NumberBC015969
Gene Symbol ICAM-1
Gene ID (NCBI) 3383
ENSEMBL Gene IDENSG00000090339
Conjugate APC Fluorescent Dye
Excitation/Emission Maxima Wavelengths650 nm / 660 nm
Excitation LaserRed Laser (633 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP05362
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

ICAM-1 (CD54) is a 90-kDa transmembrane glycoprotein of the immunoglobulin superfamily and is critical for the firm attachment and transmigration of leukocytes out of blood vessels and into tissues (PMID: 19307690). ICAM-1 is expressed by several cell types, typically on endothelial cells and cells of the immune system, and its expression can be up-regulated by various stimuli, including TNF-α, INF-γ, IL-1 and thrombin (PMID: 3086451; 9694714; 15979056). It is a ligand for LFA-1 and Mac-1, serves as a receptor for rhinovirus, and is one of several receptors used by Plasmodium falciparum (PMID: 2566624; 2538244; 2475784).

Protocols

Product Specific Protocols
FC protocol for APC ICAM-1/CD54 antibody APC-FcA98011Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...