FcZero-rAb® APC Anti-Mouse ICOS/CD278 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• FcZero-rAb® APC Anti-Mouse ICOS/CD278 Rabbit Recombinant Antibody (APC-FcA98341)

• Zero Fc receptor binding
• Site-specific conjugation
• One universal isotype

ICOS/CD278 FcZero-rAb^® Recombinant Antibody for FC

Cat No. APC-FcA98341 Copied!

Clone No. 242639C3

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

Activation-inducible lymphocyte immunomediatory molecule, Ailim, CCLP, CD278, CD28 and CTLA-4-like protein

• 

  FC experiment of BALB/c spleen cells using APC-FcA98341

  1x10^6 untreated (left) or anti-CD3/CD28 treated (right) BALB/c spleen cells were surface stained with FcZero-rAb™ PE Anti-Mouse CD3e (145-2C11) and 0.1 ug APC Anti-Mouse ICOS/CD278 Rabbit RecAb (APC-FcA98341, Clone:242639C3). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of BALB/c spleen cells using APC-FcA98341

  1x10^6 anti-CD3/CD28 treated BALB/c spleen cells were surface stained with 0.1 ug APC Anti-Mouse ICOS/CD278 Rabbit RecAb (APC-FcA98341, Clone: 242639C3) (red) or FcZero-rAb™ APC Rabbit IgG Isotype Control Recombinant Antibody (APC-FcA98136, Clone: 240953C9) (blue). 1x10^6 untreated BALB/c spleen cells were surface stained with 0.1 ug APC Anti-Mouse ICOS/CD278 Rabbit RecAb (APC-FcA98341, Clone: 242639C3) (black, dashed). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ICOS/CD278 in ?

Chat with Able

---

Tested Applications

• Positive FC detected in: anti-CD3/CD28 treated BALB/c spleen cells

Recommended dilution

• Flow Cytometry (FC): FC : 0.1 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

APC-FcA98341 targets ICOS/CD278 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3198

  Product name: Recombinant Mouse ICOS/CD278 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 21-144 aa of NM_017480.2

  Sequence: EINGSADHRMFSFHNGGVQISCKYPETVQQLKMRLFREREVLCELTKTKGSGNAVSIKNPMLCLYHLSNNSVSFFLNNPDSSQGSYYFCSLSIFDPPPFQERNLSGGYLHIYESQLCCQLKLWL

• Full Name: inducible T-cell co-stimulator
• Calculated Molecular Weight: 23kDa
• GenBank Accession Number: NM_017480.2
• Gene Symbol: Icos
• Gene ID (NCBI): 54167
• RRID: AB_3746633
• Conjugate: APC Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm
• Excitation Laser: Red Laser (633 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9WVS0
• Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Inducible T cell co-stimulator (ICOS) is related to the CD28 superfamily and is highly expressed on activated T cells as well as regulatory T cells and is crucial for the survival and function of T cells, Th2 cell differentiation, and lung inflammatory responses. Binding ICOS to ICOS-ligand (ICOS-L) activates a cascade of intracellular signaling molecules that prevent apoptosis and lead to the production of cytokines such as IL-4 and IL-13.