Use Able AI chat for product recommendations
  • Site-specific conjugation

CoraLite® Plus 488 Anti-Human ICOS/CD278 Rabbit scFv Antibody

ICOS/CD278 Recombinant Antibody for FC

Cat No. CL488-SF98214
Clone No.241770G11

Host / Type

Rabbit / scFv

Reactivity

human

Applications

FC

ICOS, Activation-inducible lymphocyte immunomediatory molecule, AILIM, CD278, CVID1

Formulation:  HEPES, EDTA, CHAPS, Sucrose, Proclin300
HEPES, EDTA, CHAPS, Sucrose, Proclin300
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inPHA treated human PBMCs

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-SF98214 targets ICOS/CD278 in FC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Type Rabbit / scFv
Class Recombinant
Type Single-chain variable fragment antibody (scFv)
Immunogen

CatNo: Eg1642

Product name: recombinant human ICOS protein

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 21-140 aa of BC028210

Sequence: EINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLK

Predict reactive species
Full Name inducible T-cell co-stimulator
Calculated Molecular Weight 199 aa, 23 kDa
GenBank Accession NumberBC028210
Gene Symbol ICOS
Gene ID (NCBI) 29851
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
SourceAnti-Human ICOS/CD278 scFv from clone 241770G11, consisting of VH-GGGGS linker-VL (N- to C-terminus), with a His tag at the C-terminus.
FormLiquid
Purification MethodAffinity purification
Storage Buffer 50mM HEPES, 150mM NaCl, 5mM EDTA, 0.1% CHAPS, 10% Sucrose and 0.1% Proclin300, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment. 20ul sizes contain 0.1% BSA.

Background Information

Inducible T cell co-stimulator (ICOS) is related to the CD28 superfamily and is highly expressed on activated T cells as well as regulatory T cells and is crucial for the survival and function of T cells, Th2 cell differentiation, and lung inflammatory responses. Binding ICOS to ICOS-ligand (ICOS-L) activates a cascade of intracellular signaling molecules that prevent apoptosis and lead to the production of cytokines such as IL-4 and IL-13.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 ICOS/CD278 antibody CL488-SF98214Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...