• Zero Fc receptor binding
  • Site-specific conjugation
  • One universal isotype

FcZero-rAb™ PE Anti-Human ICOS/CD278 Rabbit Recombinant Antibody

ICOS/CD278 FcZero-rAbTM Recombinant Antibody for FC
Cat No. PE-FcA98214
Clone No.241770G11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

ICOS, Activation-inducible lymphocyte immunomediatory molecule, AILIM, CD278, CVID1

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Conjugate:  PE
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inPHA treated human PBMCs

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 5 ul per 10^6 cells in 100 μl suspension
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.
Sample-dependent, Check data in validation data gallery.

Product Information

PE-FcA98214 targets ICOS/CD278 in FC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1642

Product name: recombinant human ICOS protein

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 21-140 aa of BC028210

Sequence: EINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLK

Predict reactive species
Full Name inducible T-cell co-stimulator
Calculated Molecular Weight 199 aa, 23 kDa
GenBank Accession NumberBC028210
Gene Symbol ICOS
Gene ID (NCBI) 29851
Conjugate PE Fluorescent Dye
Excitation/Emission Maxima Wavelengths496 nm, 565 nm / 578 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9Y6W8
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Inducible T cell co-stimulator (ICOS) is related to the CD28 superfamily and is highly expressed on activated T cells as well as regulatory T cells and is crucial for the survival and function of T cells, Th2 cell differentiation, and lung inflammatory responses. Binding ICOS to ICOS-ligand (ICOS-L) activates a cascade of intracellular signaling molecules that prevent apoptosis and lead to the production of cytokines such as IL-4 and IL-13.

Protocols

Product Specific Protocols
FC protocol for PE ICOS/CD278 antibody PE-FcA98214Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...