ID2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ID2 Polyclonal antibody, PBS Only (12502-1-PBS)

• 

  WB analysis using 12502-1-AP (same clone as 12502-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12502-1-AP (ID2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12502-1-PBS in a different storage buffer formulation.

ID2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 12502-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

bHLHb26, Class B basic helix-loop-helix protein 26, DNA-binding protein inhibitor ID-2

---

Product Information

12502-1-PBS targets ID2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3179

  Product name: Recombinant human ID2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-134 aa of BC030639

  Sequence: MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG

• Full Name: inhibitor of DNA binding 2, dominant negative helix-loop-helix protein
• Calculated Molecular Weight: 134 aa, 15 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC030639
• Gene Symbol: ID2
• Gene ID (NCBI): 3398
• RRID: AB_3741829
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q02363
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.