ID3 Recombinant monoclonal antibody, PBS Only (Capture)

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• ID3 Recombinant monoclonal antibody, PBS Only (Capture) (86979-1-PBS)

• 

  WB analysis using 86979-1-RR (same clone as 86979-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86979-1-RR (ID3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86979-1-PBS in a different storage buffer formulation.

• 

  Sandwich ELISA sample test of MP02842-1

  The mean ID3 concentration was determined to be 55.78 ng/mL in HeLa cell extract based on a 1.2 mg/mL extract load and 17.49 ng/mL in HEK-293 cell extract based on a 1.2 mg/mL extract load.

• 

  Sandwich ELISA standard curve of MP02842-1

  Sandwich ELISA standard curve of MP02842-1, Human ID3 Recombinant Matched Antibody Pair - PBS only. 86979-1-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag0588. 86979-2-PBS was HRP conjugated as the detection antibody. Range: 39.1-2500 pg/mL

• 

  IF Staining of HeLa using 86979-1-RR (same clone as 86979-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using ID3 antibody (86979-1-RR, Clone: 252047B8 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 86979-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86979-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86979-1-RR against Human ID3 were performed. The affinity constant is 0.184 nM.

ID3 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Sandwich ELISA, Indirect ELISA

Cat No. 86979-1-PBS

Clone No.252047B8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Sandwich ELISA, Indirect ELISA

Synonyms

1R21, bHLHb25, Class B basic helix-loop-helix protein 25, DNA-binding protein inhibitor ID-3, HEIR 1

---

Product Information

86979-1-PBS targets ID3 as part of a matched antibody pair:

MP02842-1: 86979-1-PBS capture and 86979-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0588

  Product name: Recombinant human ID3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-119 aa of BC003107

  Sequence: MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELAPELVISNDKRSFCH

• Full Name: inhibitor of DNA binding 3, dominant negative helix-loop-helix protein
• Calculated Molecular Weight: 119 aa, 13 kDa
• Observed Molecular Weight: 13-15 kDa
• GenBank Accession Number: BC003107
• Gene Symbol: ID3
• Gene ID (NCBI): 3399
• RRID: AB_3745251
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q02535
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The helix-loop-helix (HLH) family of transcription factors plays a central role in the regulation of cell growth, differentiation and tumourigenesis. Members of the Id (inhibitor of DNA binding) class of these nuclear proteins are able to heterodimerise with and thereby antagonise the functions of other transcription factors of this family. Inhibitor of DNA binding 3, dominant negative helix-loop-helix protein (ID3, synonym: HEIR-1) is a member of the ID family of HLH proteins, which lacks a basic DNA-binding domain and inhibits transcription through formation of nonfunctional dimers that are incapable of binding to DNA.