ID4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ID4 Polyclonal antibody, PBS Only (21803-1-PBS)

• 

  WB analysis using 21803-1-AP (same clone as 21803-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21803-1-AP (ID4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21803-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 21803-1-AP (same clone as 21803-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 21803-1-AP (ID4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21803-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 21803-1-AP (same clone as 21803-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 21803-1-AP (ID4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21803-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat testis using 21803-1-AP (same clone as 21803-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 21803-1-AP (ID4 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21803-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat testis using 21803-1-AP (same clone as 21803-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 21803-1-AP (ID4 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21803-1-PBS in a different storage buffer formulation.

ID4 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 21803-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

21803-1-PBS targets ID4 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16883

  Product name: Recombinant human ID4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-70 aa of BC014941

  Sequence: MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCLQCDMND

• Full Name: inhibitor of DNA binding 4, dominant negative helix-loop-helix protein
• Calculated Molecular Weight: 161 aa, 17 kDa
• Observed Molecular Weight: 25-30 kDa
• GenBank Accession Number: BC014941
• Gene Symbol: ID4
• Gene ID (NCBI): 3400
• RRID: AB_3085673
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P47928
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ID4 (inhibitor of DNA binding 4) negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. (PMID: 19783986). ID4 levels dictate the stem cell state in mouse spermatogonia (PMID: 28087628). It is involved in the regulation of many cellular processes during both prenatal development and tumorigenesis. ID4 can be detected 25-30 kDa (PMID: 34108007, PMID: 31847356).