Product Information
21803-1-PBS targets ID4 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16883 Product name: Recombinant human ID4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC014941 Sequence: MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCLQCDMND Predict reactive species |
| Full Name | inhibitor of DNA binding 4, dominant negative helix-loop-helix protein |
| Calculated Molecular Weight | 161 aa, 17 kDa |
| Observed Molecular Weight | 25-30 kDa |
| GenBank Accession Number | BC014941 |
| Gene Symbol | ID4 |
| Gene ID (NCBI) | 3400 |
| RRID | AB_3085673 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P47928 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
ID4 (inhibitor of DNA binding 4) negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. (PMID: 19783986). ID4 levels dictate the stem cell state in mouse spermatogonia (PMID: 28087628). It is involved in the regulation of many cellular processes during both prenatal development and tumorigenesis. ID4 can be detected 25-30 kDa (PMID: 34108007, PMID: 31847356).









