IDH2 Monoclonal antibody, PBS Only

• 

  WB analysis using 66918-1-Ig (same clone as 66918-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66918-1-Ig (IDH2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66918-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 66918-1-Ig (same clone as 66918-1-PBS)

  WB result of IDH2 antibody (66918-1-Ig; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-IDH2 transfected HEK-293 cells. This data was developed using the same antibody clone with 66918-1-PBS in a different storage buffer formulation.

• 

  WB analysis of SH-SY5Y using 66918-1-Ig (same clone as 66918-1-PBS)

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 66918-1-Ig (IDH2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66918-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 66918-1-Ig (same clone as 66918-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 66918-1-Ig (IDH2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66918-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 66918-1-Ig (same clone as 66918-1-PBS)

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug IDH2 Monoclonal antibody (66918-1-Ig, Clone:1F10A10) and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1)(red), or 0.25 ug Mouse IgG1 Isotype Control (MOPC-21) (65124-1-Ig, Clone: MOPC-21) (blue). Cells were fixed with 4% PFA and permeabilized with Intracellular Staining Permeabilization Wash Buffer. This data was developed using the same antibody clone with 66918-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

IDH2 Monoclonal Antibody for WB, FC (Intra), Indirect ELISA

Cat No. 66918-1-PBS

Clone No.1F10A10

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, FC (Intra), Indirect ELISA

Synonyms

IDHM, IDH 2, ICD-M, ICD M, EC:1.1.1.42

---

Product Information

66918-1-PBS targets IDH2 in WB, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8950

  Product name: Recombinant human IDH2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 104-452 aa of BC009244

  Sequence: TQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFKMVFTPKDGSGVKEWEVYNFPAGGVGMGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDKNKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ

• Full Name: isocitrate dehydrogenase 2 (NADP+), mitochondrial
• Calculated Molecular Weight: 452 aa, 51 kDa
• Observed Molecular Weight: 41-47 kDa
• GenBank Accession Number: BC009244
• Gene Symbol: IDH2
• Gene ID (NCBI): 3418
• RRID: AB_2882245
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P48735
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

IDH2, also named as IDP and ICD-M, belongs to the isocitrate and isopropylmalate dehydrogenases family. It plays a role in intermediary metabolism and energy production. IDH2 is a mitochondrial NADP-dependent isocitrate dehydrogenase that catalyzes oxidative decarboxylation of isocitrate to alpha-ketoglutarate, producing NADPH. It may tightly associate or interact with the pyruvate dehydrogenase complex. IDH1 and IDH2 mutations could also contribute to tumorigenesis and cancer progression through increased mutagenesis. IDH2 has 2 isoforms with the MW of 51 kDa and 45 kDa, and the mature form is about 47 kDa and 41 kDa with the N-terminal transit peptide cleaved.