IDH2 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• IDH2 Monoclonal antibody (66918-1-Ig)

• Featured Product
• KD/KO Validated

IDH2 Monoclonal Antibody for WB, FC (Intra), ELISA

Cat No. 66918-1-Ig

Clone No.1F10A10

Publications(2)

Host / Isotype

Mouse / IgG1

Reactivity

human and More (2)

Applications

WB, FC (Intra), ELISA

Synonyms

1F10A10, EC:1.1.1.42, ICD M, ICD-M, IDH 2

• 

  WB analysis using 66918-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66918-1-Ig (IDH2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 66918-1-Ig

  WB result of IDH2 antibody (66918-1-Ig; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-IDH2 transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of SH-SY5Y using 66918-1-Ig

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 66918-1-Ig (IDH2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 66918-1-Ig

  HepG2 cells were subjected to SDS PAGE followed by western blot with 66918-1-Ig (IDH2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HepG2 using 66918-1-Ig

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug IDH2 Monoclonal antibody (66918-1-Ig, Clone:1F10A10) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1)(red), or 0.25 ug Mouse IgG1 Isotype Control (MOPC-21) (65124-1-Ig, Clone: MOPC-21) (blue). Cells were fixed with 4% PFA and permeabilized with Intracellular Staining Permeabilization Wash Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: Jurkat cells, HEK-293 cells, HepG2 cells, SH-SY5Y cells, K-562 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66918-1-Ig targets IDH2 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8950

  Product name: Recombinant human IDH2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 104-452 aa of BC009244

  Sequence: TQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFKMVFTPKDGSGVKEWEVYNFPAGGVGMGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDKNKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ

• Full Name: isocitrate dehydrogenase 2 (NADP+), mitochondrial
• Calculated Molecular Weight: 452 aa, 51 kDa
• Observed Molecular Weight: 41-47 kDa
• GenBank Accession Number: BC009244
• Gene Symbol: IDH2
• Gene ID (NCBI): 3418
• RRID: AB_2882245
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P48735
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IDH2, also named as IDP and ICD-M, belongs to the isocitrate and isopropylmalate dehydrogenases family. It plays a role in intermediary metabolism and energy production. IDH2 is a mitochondrial NADP-dependent isocitrate dehydrogenase that catalyzes oxidative decarboxylation of isocitrate to alpha-ketoglutarate, producing NADPH. It may tightly associate or interact with the pyruvate dehydrogenase complex. IDH2 contains an N-terminal mitochondrial addressing sequence and hence is imported to the mitochondrial matrix, although localization to nuclei has also been reported. Moreover, IDH2, like ~20% of other mitochondrial enzymes, is acetylated at lysines, which inactivates the enzymatic activity.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse, rat	WB	Nat Commun; Pyruvate metabolism enzyme Dlat induces mitochondria protein hyperacetylation to limit fatty acid oxidation in the HFpEF heart.; Authors - Ying Wang
human	WB	Sci Adv; RIPK3 deficiency blocks R-2-hydroxyglutarate-induced necroptosis in IDH-mutated AML cells; Authors - Shuanghong Zhu