• Featured Product
  • KD/KO Validated

IDH2 Recombinant monoclonal antibody, PBS Only

IDH2 Uni-rAb® Recombinant Antibody for WB, IHC, IP, Indirect ELISA
Cat No. 82117-1-PBS
Clone No.1B1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

1B1, EC:1.1.1.42, ICD M, ICD-M, IDH 2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82117-1-PBS targets IDH2 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag8779

Product name: Recombinant human IDH2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 104-452 aa of BC009244

Sequence: TQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFKMVFTPKDGSGVKEWEVYNFPAGGVGMGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDKNKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ

Predict reactive species
Full Name isocitrate dehydrogenase 2 (NADP+), mitochondrial
Calculated Molecular Weight 452 aa, 51 kDa
Observed Molecular Weight43 kDa
GenBank Accession NumberBC009244
Gene Symbol IDH2
Gene ID (NCBI) 3418
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP48735
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

IDH2, also named as IDP and ICD-M, belongs to the isocitrate and isopropylmalate dehydrogenases family. It plays a role in intermediary metabolism and energy production. IDH2 is a mitochondrial NADP-dependent isocitrate dehydrogenase that catalyzes oxidative decarboxylation of isocitrate to alpha-ketoglutarate, producing NADPH. It may tightly associate or interact with the pyruvate dehydrogenase complex. IDH2 contains an N-terminal mitochondrial addressing sequence and hence is imported to the mitochondrial matrix, although localization to nuclei has also been reported. Moreover, IDH2, like ~20% of other mitochondrial enzymes, is acetylated at lysines, which inactivates the enzymatic activity.

Loading...
||
New chat

Able

正在加载,请稍候...