IDH2 Recombinant monoclonal antibody

• 

  WB analysis using 82117-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 82117-1-RR (IDH2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 82117-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 82117-1-RR (IDH2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 82117-1-RR

  WB result of IDH2 antibody (82117-1-RR; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-IDH2 transfected HEK-293 cells.

• 

  IP experiment of mouse brain using 82117-1-RR

  IP result of anti-IDH2 (IP:82117-1-RR, 4ug; Detection:82117-1-RR 1:1000) with mouse brain tissue lysate 1280 ug.

• 

  IHC staining of human colon cancer using 82117-1-RR

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 82117-1-RR (IDH2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Sodium Citrate buffer (pH 6.0).

• Featured Product
• KD/KO Validated

IDH2 Uni-rAb^® Recombinant Antibody for WB, IHC, IP, ELISA

Cat No. 82117-1-RR

Clone No.1B1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

IDHM, IDH 2, ICD-M, ICD M, EC:1.1.1.42

---

Tested Applications

• Positive WB detected in: LNCaP cells, HEK-293 cells, mouse heart tissue, Jurkat cells, rat heart tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

82117-1-RR targets IDH2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag8779

  Product name: Recombinant human IDH2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 104-452 aa of BC009244

  Sequence: TQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFKMVFTPKDGSGVKEWEVYNFPAGGVGMGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDKNKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ

• Full Name: isocitrate dehydrogenase 2 (NADP+), mitochondrial
• Calculated Molecular Weight: 452 aa, 51 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: BC009244
• Gene Symbol: IDH2
• Gene ID (NCBI): 3418
• RRID: AB_3086464
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P48735
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IDH2, also named as IDP and ICD-M, belongs to the isocitrate and isopropylmalate dehydrogenases family. It plays a role in intermediary metabolism and energy production. IDH2 is a mitochondrial NADP-dependent isocitrate dehydrogenase that catalyzes oxidative decarboxylation of isocitrate to alpha-ketoglutarate, producing NADPH. It may tightly associate or interact with the pyruvate dehydrogenase complex. IDH1 and IDH2 mutations could also contribute to tumorigenesis and cancer progression through increased mutagenesis. IDH2 has 2 isoforms with the MW of 51 kDa and 45 kDa, and the mature form is about 47 kDa and 41 kDa with the N-terminal transit peptide cleaved.