IFI16 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• IFI16 Polyclonal antibody, PBS Only (29280-1-PBS)

• 

  WB analysis using 29280-1-AP (same clone as 29280-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29280-1-AP (IFI16 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29280-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human renal cell carcinoma using 29280-1-AP (same clone as 29280-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 29280-1-AP (IFI16 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29280-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human renal cell carcinoma using 29280-1-AP (same clone as 29280-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 29280-1-AP (IFI16 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29280-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 29280-1-AP (same clone as 29280-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using IFI16 antibody (29280-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 29280-1-PBS in a different storage buffer formulation.

IFI16 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 29280-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

29280-1-PBS targets IFI16 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30297

  Product name: Recombinant human IFI16 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 580-729 aa of BC017059

  Sequence: VCRNGFLEVYPFTLVADVNADRNMEIPKGLIRSASVTPKINQLCSQTKGSFVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIKTRKNKKDILNPDSSMETSPDFFF

• Full Name: interferon, gamma-inducible protein 16
• Calculated Molecular Weight: 729 aa, 82 kDa
• Observed Molecular Weight: 85-95 kDa
• GenBank Accession Number: BC017059
• Gene Symbol: IFI16
• Gene ID (NCBI): 3428
• RRID: AB_3086109
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16666
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

IFI16 is a member of a family of interferon-inducible nuclear proteins involved in transcriptional regulation functions as a transcriptional repressor. IFI16 may be involved in TP53-mediated transcriptional activation by enhancing TP53 sequence-specific DNA binding and modulating TP53 phosphorylation status. It has been reported that IFI16 participates in the regulation of autophagy, TP53-mediated cell death and innate immune response. IFI16 has different isoforms and 67790-1-Ig antibody detects proteins around 85-95 kDa in SDS-PAGE similar to papers. (PMID: 9718316, 14990579, 11146555, 22046441)