IFI35 Recombinant monoclonal antibody, PBS Only (Capture)

IFI35 Uni-rAb® Recombinant Antibody for IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA
Cat No. 83160-2-PBS
Clone No.240063C6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

240063C6, Ifi 35, Ifi-35, IFP 35, IFP35

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83160-2-PBS targets IFI35 as part of a matched antibody pair:

MP00191-2: 83160-2-PBS capture and 83160-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag34653

Product name: Recombinant human IFI35 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 30-203 aa of BC001356

Sequence: RKELGDSPKDKVPFSVPKIPLVFRGHTQQDPEVPKSLVSNLRIHCPLLAGSALITFDDPKVAEQVLQQKEHTINMEECRLRVQVQPLELPMVTTIQVMVSSQLSGRRVLVTGFPASLRLSEEELLDKLEIFFGKTRNGGGDVDVRELLPGSVMLGFARDGVAQRLCQIGQFTVP

Predict reactive species
Full Name interferon-induced protein 35
Calculated Molecular Weight 31 kDa
GenBank Accession NumberBC001356
Gene Symbol IFI35
Gene ID (NCBI) 3430
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP80217
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

IFI35 (interferon induced protein 35), also known as IFP35. It is expected to be located in cytoplasm, nucleus and extracellular space. The protein is expressed in a wide range of cell types, including fibroblasts, macrophages, and epithelial cells. Involved in several processes, including macrophage activation involved in immune response; positive regulation of defense response; and regulation of signal transduction. And the calculated molecular weight of IFI35 is 31 kDa.

Loading...
||
New chat Able
正在加载,请稍候...