IFIH1/MDA5 Monoclonal antibody, PBS Only

• 

  WB analysis using 66770-1-Ig (same clone as 66770-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66770-1-Ig (IFIH1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66770-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66770-1-Ig (same clone as 66770-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66770-1-Ig (IFIH1/MDA5 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Alpha Tubulin Monoclonal antibody (HRP-66031) as loading control. This data was developed using the same antibody clone with 66770-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66770-1-Ig (same clone as 66770-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66770-1-Ig (IFIH1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66770-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66770-1-Ig (same clone as 66770-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66770-1-Ig (IFIH1/MDA5 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66770-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66770-1-Ig (same clone as 66770-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66770-1-Ig (IFIH1/MDA5 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66770-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 66770-1-Ig (same clone as 66770-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 66770-1-Ig (IFIH1/MDA5 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66770-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 66770-1-Ig (same clone as 66770-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 66770-1-Ig (IFIH1/MDA5 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66770-1-PBS in a different storage buffer formulation.

• 

  FC experiment of Jurkat using 66770-1-Ig (same clone as 66770-1-PBS)

  1x10^6 Jurkat cells were intracellularly stained with 0.25 ug IFIH1/MDA5 Monoclonal antibody (66770-1-Ig, Clone:3D8B11) and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1)(red), or 0.25 ug Mouse IgG1 isotype control Mouse McAb (66360-1-Ig, Clone: 1F8D3) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 66770-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

IFIH1/MDA5 Monoclonal Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 66770-1-PBS

Clone No.3D8B11

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, FC (Intra), ELISA

Synonyms

IFIH1, MDA5, 3D8B11, CADM-140 autoantigen, Clinically amyopathic dermatomyositis autoantigen 140 kDa

---

Product Information

66770-1-PBS targets IFIH1/MDA5 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17448

  Product name: Recombinant human IFIH1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-310 aa of BC111750

  Sequence: MSNGYSTDENFRYLISCFRARVKMYIQVEPVLDYLTFLPAEVKEQIQRTVATSGNMQAVELLLSTLEKGVWHLGWTREFVEALRRTGSPLAARYMNPELTDLPSPSFENAHDEYLQLLNLLQPTLVDKLLVRDVLDKCMEEELLTIEDRNRIAAAENNGNESGVRELLKRIVQKENWFSAFLNVLRQTGNNELVQELTGSDCSESNAEIENLSQVDGPQVEEQLLSTTVQPNLEKEVWGMENNSSESSFADSSVVSESDTSLAEGSVSCLDESLGHNSNMGSDSGTMGSDSDEENVAARASPEPELQLRP

• Full Name: interferon induced with helicase C domain 1
• Calculated Molecular Weight: 1025 aa, 117 kDa
• Observed Molecular Weight: 117-125 kDa
• GenBank Accession Number: BC111750
• Gene Symbol: IFIH1
• Gene ID (NCBI): 64135
• RRID: AB_2882116
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9BYX4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

IFIH1 (Interferon-induced helicase C domain-containing protein 1) is a putative RNA helicase that is upregulated in response to treatment with IFNB or IFNB and MEZ. It is also named as MDA5 and RH116. Ectopic expression of MDA5 in melanoma cells resulted in reduced colony formation, suggesting an interaction of the CARD and apoptotic signal molecules. Functional analysis indicated that MDA5 is an RNA-dependent ATPase. IFIH1 has an apparent molecular mass of 117-130 kDa, and always other bands (70 kDa and 90 kDa) can be detected as cleaved products (PMID: 17267501).